(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE126

ALDEN1_2.PE126       Location/Qualifiers
FT   CDS_pept        complement(139694..140122)
FT                   /locus_tag="Alide_0127"
FT                   /gene_family="HOG000229492" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /codon_start="1"
FT                   /product="hemerythrin hhe cation binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: dia:Dtpsy_0108 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760864"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:10102150"
FT                   /translation="MNIDRFKHDHVDILGQIDRLRQLAHAGVEGNAAAIARGIVAISST
FT                   IKLHLAVEDRLLYPALSQSGNPELARLSQRFQHDMGSIATAFMAFARRWNTAESVRGDP
FT                   QSFRREANDVLRRVYERMQRENREFYPRIEAEEAMATH"
FT                   /protein_id="YP_004124801.1"
     atgaacatcg accgtttcaa gcatgaccac gtggacatcc tggggcagat cgaccggctg        60
     cgccagctcg cccacgctgg agtggagggc aacgccgccg cgatcgcacg cggcatcgtg       120
     gccatcagct ccaccatcaa gctgcacctg gcggtggaag accgccttct gtacccggcg       180
     ctgagccagt ccggcaaccc cgagctggcg cgcctgagcc agcgcttcca gcacgacatg       240
     ggctccatcg ccacggcctt catggccttc gcgcggcgct ggaacaccgc cgagagcgtg       300
     cgcggcgatc cccagtcctt ccgccgcgaa gccaacgacg tgctgcgccg cgtctacgag       360
     cgcatgcagc gcgagaaccg cgagttctac ccgcgcatcg aggccgagga ggcgatggcg       420
     acgcactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page