(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE127

ALDEN1_2.PE127       Location/Qualifiers
FT   CDS_pept        complement(140192..142501)
FT                   /locus_tag="Alide_0128"
FT                   /gene_family="HOG000288072" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0109"
FT                   /codon_start="1"
FT                   /product="nitric oxide reductase large subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0109 nitric oxide reductase large
FT                   subunit"
FT                   /db_xref="GI:319760865"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="GeneID:10102151"
FT                   /translation="MGKYAKYWYTLIGVLIVTFSLLGYYGAEVYRTAPPIPGQVLVQGS
FT                   DKPLYTKDSILDGQTAWQSVGGMQLGSILGHGAYQAPDWTADWLHRELTAWLELAAQKD
FT                   YGKSFAELDAGQQAVLRDRLKTEYRTNTYDQAKDTVVISPLRAQAIAETAQYYDKLFSD
FT                   DPSLHKSRESFAMKENTLPSAERRAQMAGFFFWTAWAAATERPTDVGGGNGATYTNNWP
FT                   HEPLIGNQPTGENMVWSVMSVVIMMAGVGFLVWGWAFLRKHDEQDPVPPAHDPLSRVAL
FT                   TPSQRALGKYLFLVVALFVFQVFIGGFTAHYTLEGQKFYGIDLSQWFPYALTRTWHIQA
FT                   ALFWIATGFLAAGLFLAPVINGGKDPKYQKLGVDVLFWALVVVCVGSFIGNYLAIAHIL
FT                   PKEWSFWLGHQGYEYVDLGRLWQIGKFAGIAFWLLLMARAIFPALLAPNGQDKNLLALL
FT                   TSSVVCIGLFYGTGLFYGERTHISVMEYWRWWVVHLWVEGFFEVFATTALAFIFSTLGL
FT                   VSYRMATAASLASASLFMLGGVPGTFHHLYFAGTTTPVMAVGASFSALEVVPLVVLGHE
FT                   AWEHWRLQHKTPWMADLRWPLMCFVAVAFWNMLGAGVFGFMINPPISLYYIQGLNTTPV
FT                   HAHAALFGVYGFLALGFTLLVLRYVRPQMVFNERLMKTGFWWLNAGLVLMISTSLLPIG
FT                   LFQFHASVTHGLWYARSEEFLQQPFLETLRWIRTFGDVVFITGALCVAWQVASAVLFGA
FT                   RTPAAPSTGALAGASR"
FT                   /protein_id="YP_004124802.1"
     atggggaaat acgccaagta ttggtacacg ctcataggcg tgttgatcgt caccttcagc        60
     ctgttgggct attacggtgc cgaggtttat cgcactgcgc cgccgattcc ggggcaggtg       120
     ctggtgcagg gtagcgacaa gccgctctac accaaggaca gcatcctgga cggccagacc       180
     gcctggcagt ccgtgggcgg catgcagctg ggctccatcc tgggccacgg cgcctaccag       240
     gccccggact ggacggccga ctggctgcac cgcgagctca ccgcctggct ggagctggcc       300
     gcgcagaagg actacggcaa gtccttcgcc gagctcgacg cgggccagca ggccgtgctg       360
     cgcgaccggc tcaagaccga gtaccgcacc aacacctatg accaggccaa ggacacggtg       420
     gtgatctcgc cgctgcgcgc ccaggccatc gccgagacgg cccagtacta cgacaagctg       480
     ttcagcgacg acccgtcgct gcacaagtcg cgcgagagct tcgccatgaa ggagaacacc       540
     ctgcccagcg ccgagcgccg cgcgcagatg gccggcttct tcttctggac cgcctgggca       600
     gccgccaccg agcgccccac cgacgtgggc ggcggcaacg gcgccaccta caccaacaac       660
     tggccgcacg agcccctgat cggcaaccag ccgacgggcg agaacatggt ctggtccgtc       720
     atgagcgtgg tcatcatgat ggccggcgtg ggcttcctcg tgtggggctg ggcgttcctg       780
     cgcaagcatg acgagcagga ccccgtcccg cccgcgcacg accccctgag ccgcgtggcc       840
     ctgacgccct cgcagcgcgc gctgggcaag tacctgttcc tggtcgtggc gctgttcgtt       900
     ttccaggtgt tcatcggcgg cttcaccgcc cactacacgc tcgaaggcca gaagttctac       960
     ggcatcgacc tttcgcagtg gttcccctac gcgctcacgc gcacctggca catccaggcc      1020
     gccctgttct ggatcgccac gggcttcctg gccgcaggcc tgttcctggc cccggtgatc      1080
     aatggcggca aggaccccaa gtaccagaag ctcggcgtgg acgtgctgtt ctgggcgctg      1140
     gtcgtggtct gcgtgggctc cttcatcggc aactacctgg ccatcgccca catcctgccc      1200
     aaggagtgga gcttctggct cggccaccag ggctatgagt atgtggacct ggggcgcctg      1260
     tggcagatcg gcaagttcgc cggcatcgcc ttctggctgc tgctgatggc gcgcgccatc      1320
     ttccccgcgc tgctggcccc caacggccag gacaagaacc tgctggccct gctgacctcg      1380
     tcggtcgtgt gcatcggcct gttctacggc accggcctgt tctacggcga gcgcacccac      1440
     atctcggtga tggagtactg gcgctggtgg gtggtgcacc tgtgggtgga gggcttcttc      1500
     gaagtcttcg cgaccacggc gctggccttc atcttctcga ccctgggcct ggtgtcctac      1560
     cgcatggcca cggccgccag cctggcatcg gcatcgctct tcatgctggg cggcgtgccc      1620
     ggcaccttcc accacctgta cttcgccggc accaccactc ccgtgatggc cgtgggcgca      1680
     tccttcagcg cgctggaagt cgtgccgctg gtggtgctgg gccatgaggc ctgggaacac      1740
     tggcgcctgc agcacaagac gccgtggatg gccgacctgc gctggccgct gatgtgcttc      1800
     gtggccgtgg ccttctggaa catgctgggc gccggcgtgt tcggcttcat gatcaacccg      1860
     ccgatctcgc tgtactacat ccagggcctg aacaccacgc cggtgcacgc ccacgccgcc      1920
     ctgttcggtg tctatggctt cctggccctg ggcttcacgc tgctggtgct gcgctacgtg      1980
     cgcccgcaga tggtgttcaa cgagcgcctg atgaagaccg gcttctggtg gctcaacgcc      2040
     ggcctggtgc tgatgatctc caccagcctg ctgccgatcg gcctgttcca gttccacgcc      2100
     agcgtgaccc acggcctgtg gtacgcccgc agcgaggagt tcctgcagca gcccttcctg      2160
     gaaaccctgc gctggatccg caccttcggc gacgtggtgt tcatcaccgg cgccttgtgc      2220
     gtggcctggc aggtggcgag cgccgtgctg ttcggcgcac gcacgccggc cgcacccagc      2280
     accggcgcac tggctggcgc gagccgctga                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page