(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE128

ALDEN1_2.PE128       Location/Qualifiers
FT   CDS_pept        142653..144266
FT                   /locus_tag="Alide_0129"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0110 anaerobic nitric oxide
FT                   reductase transcription regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:319760866"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:10102152"
FT                   /translation="MTVKEAELATVLVDLCADLGTELPQAVRLQRLVDVLRAQFGCGAV
FT                   ALLRLEEERLRPMAVAGLVSDTLGRRFVVGQHPRLAAILARHEVTCFEHDSTLPDPYDG
FT                   LLDTLVGEPLPVHDCMGVGLHVEGRPWGVLTLDALATGTFGAAARRRLAQSVPLVEAVV
FT                   RVARLEQELRTLRMAASGPGEGGAALASSERGGVGELEIVGESPALKRLLHELGIVAAS
FT                   ELPVLLLGETGVGKELFARLLHHQSPRHDRPLVHVNCAALPESLAESELFGHVRGAFSG
FT                   AVSDRPGRFEAAEGGTLFLDEVGELPLSVQAKLLRTLQNGEIQRLGADRPRSVNVRVIA
FT                   ATNRNLREQVASGAFRADLYHRLSVYPVPIPPLRERGNDVLLLAGRFLDFNRARLGLRS
FT                   LRLSPDAQAALRRYRWPGNVRELEHVISRAALKALSRGADRNSIVTLEEGLLDLDALDV
FT                   PAADGPAAPAAPGPAAGAAAGAALAAPAGTLRDTVDACQRQAIIAALDRHQGNWAQAAR
FT                   ALDVDSSNLHKLARRLGLKS"
FT                   /protein_id="YP_004124803.1"
     ATGACCGTGA AAGAGGCCGA GCTCGCGACC GTCCTGGTGG ACTTGTGCGC CGACCTGGGC        60
     ACCGAGCTGC CCCAGGCCGT GCGGTTGCAG CGCCTGGTGG ACGTGCTGCG CGCCCAGTTC       120
     GGCTGCGGTG CCGTGGCGCT GCTGCGCCTG GAGGAAGAGC GCTTGCGCCC GATGGCCGTC       180
     GCGGGCCTGG TCAGCGACAC CCTGGGGCGG CGCTTCGTCG TGGGGCAGCA CCCGCGCCTG       240
     GCCGCGATCC TGGCGCGCCA CGAGGTGACC TGCTTCGAGC ACGACAGCAC CCTGCCCGAC       300
     CCGTACGACG GCCTGCTCGA CACCCTGGTC GGCGAGCCGC TGCCCGTGCA CGACTGCATG       360
     GGCGTGGGCC TGCACGTGGA GGGCCGGCCC TGGGGCGTGC TCACGCTCGA CGCGCTGGCC       420
     ACCGGCACCT TCGGCGCCGC GGCGCGCCGG CGCCTGGCGC AGAGCGTGCC GCTGGTCGAG       480
     GCGGTGGTGC GCGTGGCGCG ACTGGAGCAG GAGCTGCGCA CGCTGCGCAT GGCGGCCTCC       540
     GGGCCCGGGG AGGGCGGCGC GGCGCTGGCA TCGTCCGAGC GCGGCGGTGT GGGCGAGCTG       600
     GAGATCGTCG GCGAGAGCCC CGCGCTCAAG CGCCTGCTGC ACGAGCTGGG CATCGTCGCC       660
     GCCTCCGAGC TGCCCGTGCT GCTGCTGGGC GAGACCGGCG TGGGCAAGGA ACTGTTCGCG       720
     CGCCTGCTGC ACCACCAGTC GCCGCGGCAC GACCGGCCGC TGGTGCACGT GAACTGCGCG       780
     GCCCTGCCCG AATCGCTGGC CGAGAGCGAA CTCTTCGGCC ACGTGCGCGG CGCCTTTTCG       840
     GGCGCGGTGA GCGACCGGCC CGGCCGCTTC GAGGCCGCCG AGGGCGGCAC CCTGTTCCTC       900
     GACGAGGTGG GCGAGCTGCC CCTGTCGGTG CAGGCCAAGC TGCTGCGCAC GCTGCAGAAC       960
     GGCGAGATCC AGCGCCTGGG CGCCGACCGC CCGCGCAGCG TGAACGTGCG CGTGATCGCC      1020
     GCCACCAACC GCAACCTGCG CGAGCAGGTG GCCAGCGGCG CCTTCCGCGC CGACCTGTAC      1080
     CACCGCCTGT CGGTCTATCC CGTGCCCATA CCGCCGCTGC GCGAACGCGG CAACGACGTG      1140
     CTGCTGCTGG CCGGGCGCTT CCTGGACTTC AACCGCGCCC GCCTGGGGCT GCGCAGCCTG      1200
     CGCCTGTCGC CCGACGCGCA GGCCGCGCTG CGCCGCTACC GCTGGCCCGG CAACGTGCGC      1260
     GAGCTCGAAC ACGTGATCAG CCGCGCCGCC CTGAAGGCCC TGAGCCGCGG CGCGGACCGC      1320
     AACTCCATCG TCACGCTGGA GGAAGGCTTG CTGGACCTCG ACGCGCTGGA CGTGCCCGCC      1380
     GCAGACGGCC CCGCCGCGCC CGCCGCCCCC GGCCCCGCAG CGGGCGCCGC AGCGGGCGCC      1440
     GCGCTGGCAG CGCCCGCGGG CACCCTGCGC GACACCGTCG ATGCCTGCCA GCGCCAGGCC      1500
     ATCATCGCGG CCCTGGACCG CCACCAGGGC AACTGGGCCC AGGCCGCGCG CGCGCTGGAC      1560
     GTGGATTCGA GCAACCTGCA CAAGCTGGCG CGGCGGCTGG GGCTCAAAAG CTGA            1614
//

If you have problems or comments...

PBIL Back to PBIL home page