(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE129

ALDEN1_2.PE129       Location/Qualifiers
FT   CDS_pept        complement(144319..144981)
FT                   /locus_tag="Alide_0130"
FT                   /gene_family="HOG000079537" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_2843"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_2843 hypothetical protein"
FT                   /db_xref="GI:319760867"
FT                   /db_xref="InterPro:IPR014602"
FT                   /db_xref="GeneID:10102153"
FT                   /translation="MENFPQDIYTEPEPDADTLANLGPLTGMAGIWTGTRGLDVNPKAD
FT                   GPERQAFIEHMELQPIDAQTNGPQLFYGLRYHTRIVKPDGVETFHDQVGYWLWEPATGT
FT                   VIQTLSIPRGQAAMAVGHAEAGARTFRLQAVRGSTVNGIVSNTFLEHAFRTESYTITVS
FT                   IHDDGTWSYEQDTVLIIPGQAEPFHHTDRNTLRKIGEPVPNPTARAAARTPGDAQGR"
FT                   /protein_id="YP_004124804.1"
     atggaaaact tcccccaaga catctacacg gaacccgagc cggacgccga tacgctggcc        60
     aacctggggc cgctcaccgg catggccggc atatggacgg gcacgcgcgg cctcgacgtc       120
     aatccgaagg ccgatggccc cgaaaggcag gccttcatcg agcacatgga gctgcagccg       180
     atcgacgcgc agaccaacgg gccgcagctg ttctacgggc tgcgctacca cacgcggatc       240
     gtcaagccgg acggcgtgga gacgttccac gaccaggtcg gctactggct gtgggagccg       300
     gccacgggca cggtgatcca gacgctttcg ataccgcgcg gacaggcggc gatggccgtc       360
     ggccatgccg aggccggcgc gagaacgttt cgcctccagg ctgtccgcgg gtccacggtg       420
     aacggaatcg tgtcgaacac gttcctggag catgcgttca ggacggagag ctacaccatc       480
     acggtatcga tccatgacga cggaacgtgg tcctacgagc aggacacggt actcatcatc       540
     ccgggccagg cggagccgtt ccaccacacg gaccgcaaca cgctgcgcaa gattggagag       600
     cctgtgccca accccacggc gcgggcagcg gcgagaacgc ccggggacgc ccagggccgg       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page