(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE130

ALDEN1_2.PE130       Location/Qualifiers
FT   CDS_pept        145218..146606
FT                   /locus_tag="Alide_0131"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.17"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG:
FT                   dia:Dtpsy_0112 L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="GI:319760868"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="GeneID:10102154"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAARLFVQRLAREGHLPRVAR
FT                   VRCTLYGSLGATGRGHGSDRAVLLGLCGHAPDTVDVDAIEPLIARIRARHRLPLADGPE
FT                   VAFDEAADLLLVPDVALPLHANGMRFEAFDAAGGLLDAQVYYSVGGGFIVSGEAAVDAR
FT                   RQAEIAPDTEVLPLPFHSGEQLLAQAAAQGGSMARVMRVNERHWRTDSEIDAGLLAIWG
FT                   AMQDCVARGCRTGGVLPGGFRVRRRAPALHQALQGAPDTLQDPLQVIDWVNLFALAVNE
FT                   ENAAGGRVVTAPTNGAAGIVPAVLHYYWRFIAGASEAGVIDFLLTAGAIGILYKENASI
FT                   SGAEVGCQGEVGVACSMAAAGLCAVLGGMPAQVENAAEIGMEHHLGLTCDPVGGLVQIP
FT                   CIERNALAAVKAINAARMALRGDGTHHVSLDQVIKTMRETGADMMSKYKETSRGGLAVN
FT                   IVEC"
FT                   /product="l-serine dehydratase 1"
FT                   /protein_id="YP_004124805.1"
     ATGGCCGTCA GCGTTTTCGA CCTGTTCAAG ATCGGCATCG GGCCGTCCAG TTCGCACACC        60
     GTGGGGCCCA TGCGCGCCGC GCGCCTGTTC GTGCAGCGCC TGGCGCGCGA GGGCCATCTG       120
     CCCCGGGTGG CGCGCGTGCG CTGCACGCTC TACGGCTCGC TGGGCGCCAC GGGCCGCGGC       180
     CATGGGAGCG ACCGCGCCGT GCTGCTGGGG TTGTGCGGCC ACGCGCCGGA CACGGTGGAC       240
     GTGGATGCCA TCGAACCCCT GATCGCCCGC ATCCGCGCCC GGCACCGGCT GCCGCTGGCG       300
     GACGGCCCCG AGGTCGCGTT CGACGAGGCC GCCGACCTGT TGCTGGTGCC CGACGTGGCG       360
     CTGCCGCTGC ACGCCAACGG CATGCGCTTC GAGGCCTTCG ACGCCGCGGG CGGCCTGCTG       420
     GACGCGCAGG TGTACTACTC GGTCGGCGGC GGCTTCATCG TCAGCGGGGA GGCCGCCGTC       480
     GATGCCCGAC GCCAGGCCGA AATCGCGCCC GATACCGAGG TGCTGCCGCT GCCCTTTCAC       540
     AGCGGCGAGC AGCTGCTGGC GCAGGCCGCG GCCCAGGGCG GCTCCATGGC GCGGGTCATG       600
     CGCGTCAACG AGCGCCATTG GCGCACGGAC TCCGAGATCG ACGCGGGCCT GCTGGCCATC       660
     TGGGGCGCCA TGCAGGACTG CGTCGCGCGC GGCTGCCGCA CGGGCGGCGT GCTGCCCGGG       720
     GGCTTCCGGG TGCGCCGCCG CGCGCCTGCG CTGCACCAGG CGCTGCAGGG CGCTCCCGAC       780
     ACGCTGCAGG ATCCGCTGCA GGTGATCGAC TGGGTGAACC TGTTCGCCCT GGCGGTGAAC       840
     GAAGAGAACG CCGCGGGTGG CCGCGTGGTC ACCGCGCCCA CCAACGGCGC GGCGGGCATC       900
     GTGCCGGCGG TGCTGCACTA CTACTGGCGC TTCATTGCCG GCGCGAGCGA GGCCGGCGTG       960
     ATCGACTTCC TGCTCACGGC CGGCGCCATC GGCATCCTCT ACAAGGAGAA CGCCTCCATC      1020
     TCGGGCGCCG AGGTTGGTTG CCAGGGCGAG GTGGGCGTGG CCTGCTCCAT GGCCGCCGCG      1080
     GGCCTGTGCG CCGTGCTGGG CGGCATGCCC GCGCAGGTGG AGAACGCGGC CGAGATCGGC      1140
     ATGGAGCACC ACCTGGGCCT GACCTGCGAC CCGGTGGGCG GCCTGGTGCA GATCCCCTGC      1200
     ATAGAGCGCA ACGCGCTCGC CGCCGTCAAG GCCATCAACG CCGCGCGCAT GGCGCTGCGC      1260
     GGCGACGGCA CGCACCACGT GAGCCTGGAC CAGGTCATCA AGACCATGCG CGAGACGGGC      1320
     GCCGACATGA TGAGCAAGTA CAAGGAGACC TCGCGCGGCG GGCTGGCGGT CAACATCGTC      1380
     GAATGCTGA                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page