(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE131

ALDEN1_2.PE131       Location/Qualifiers
FT   CDS_pept        146738..147688
FT                   /locus_tag="Alide_0132"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0114"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0114 hypothetical protein"
FT                   /db_xref="GI:319760869"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102155"
FT                   /translation="MPLRRRLIAFCLAALPLATWAAWPERPITIVVPAAAGGTTDIAAR
FT                   VLAEKMGKDLGTAIVVENKGGGGGSIGTAQVARAKPDGYTLLMGNIGPVAINFSLYKQL
FT                   SYKESDLRGITNVISVPNILVVHADSPARSVKDLVGLAKTRRLNVSTSGVGQSPHMSSE
FT                   MFRQKAGIEVTLVPFPGAAPAVTALLGQQVDFMIDNLPSSMPHIKSGKFRALAITSGER
FT                   AAQLPDVPTMAEAGVPMQVTAWFGLLAPAGTPDAVVLRLQQSARKAMHEPDVRQRFAEL
FT                   GGVPGGETPAEYDAFIAQERKSWAQIVKAAGLSLE"
FT                   /protein_id="YP_004124806.1"
     ATGCCCCTGC GCCGCCGCCT GATCGCCTTC TGCCTGGCAG CACTTCCACT GGCCACCTGG        60
     GCCGCCTGGC CGGAGCGGCC CATCACCATC GTCGTGCCCG CCGCCGCGGG CGGCACCACC       120
     GACATCGCGG CGCGCGTGCT GGCCGAGAAG ATGGGCAAGG ACCTGGGCAC GGCCATCGTC       180
     GTCGAGAACA AGGGCGGGGG CGGCGGCAGC ATCGGCACGG CGCAGGTGGC GCGCGCCAAG       240
     CCCGACGGCT ACACGCTGCT CATGGGCAAC ATCGGCCCCG TCGCCATCAA CTTCAGCCTC       300
     TACAAGCAGC TGAGCTACAA GGAGAGCGAC CTGCGCGGCA TCACCAACGT GATTTCCGTG       360
     CCCAACATCC TCGTGGTCCA TGCCGATTCG CCCGCGCGCA GCGTGAAGGA CCTGGTCGGC       420
     CTGGCGAAGA CGCGCCGGCT CAACGTGTCC ACCTCGGGCG TGGGCCAGTC GCCGCACATG       480
     TCCTCCGAGA TGTTCCGCCA GAAGGCCGGC ATCGAGGTCA CCCTGGTGCC GTTCCCCGGC       540
     GCGGCCCCGG CCGTGACGGC GCTGCTCGGG CAGCAGGTGG ACTTCATGAT CGACAATCTG       600
     CCGAGCTCCA TGCCGCACAT CAAGTCGGGC AAGTTCCGCG CGCTGGCCAT CACCAGCGGC       660
     GAGCGCGCGG CCCAGTTGCC GGACGTGCCG ACCATGGCCG AGGCCGGCGT GCCCATGCAG       720
     GTCACGGCCT GGTTCGGCCT GCTGGCGCCG GCCGGCACGC CCGACGCGGT GGTCCTGCGC       780
     CTGCAGCAGT CGGCGCGCAA GGCCATGCAC GAGCCCGATG TGCGCCAGCG CTTCGCCGAG       840
     CTCGGCGGCG TGCCCGGCGG CGAGACGCCG GCCGAGTACG ATGCCTTCAT CGCCCAGGAA       900
     CGCAAGAGCT GGGCCCAGAT CGTCAAGGCC GCCGGCCTGT CGCTCGAATG A                951
//

If you have problems or comments...

PBIL Back to PBIL home page