(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE132

ALDEN1_2.PE132       Location/Qualifiers
FT   CDS_pept        147693..149267
FT                   /locus_tag="Alide_0133"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0098 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760870"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102156"
FT                   /translation="MPMQADIEHLLAQPFGSLPELIARQAAHRPGHTALILEERSLDYA
FT                   ALCAGMDRVARSLQQGGLGPGDVVAVCAGTSVEYLLAYLGALRAGVAVAPLAPSATAEH
FT                   LSAMLDNCGARLVLRDREVAAQWPLHAGAVLRCVALDDAPEAGEPWSQWLAQGGGAPAP
FT                   IAPAPDWAFNVIYSSGTTGVPKGIVQSWAMRWAHVRRAVTNGYGPDAVSLCATPLYSNT
FT                   TLVAALPTLALGGTLVLMRKFDAAHYLELAERHGATHTMLVPVQYQRLMACPAFDGTDL
FT                   SRLRHKFCTSAPFGAALKAEVLRRWPGRLIEYYGLTEGGVRCELHCHDFPHKLHTVGRP
FT                   GEGADIRFIDEQGRELPPGAQGEIVGRSAGMMSGYHRLPDKTREAEWFDAQGQRFIRSG
FT                   DVGRLDEDGFIVLGDRMKDMIITGGFNVYPSDIEGVLQQHPQVAECAVVGVPSEQWGET
FT                   PVAYVVPRAGAQPGARELREWLNARVGKTQRVADLRLAERLPRSEIGKVLKRELREQYL
FT                   RANPAAH"
FT                   /protein_id="YP_004124807.1"
     ATGCCCATGC AAGCAGACAT CGAACACCTG TTGGCCCAGC CCTTCGGCTC GCTGCCCGAA        60
     CTGATCGCGC GCCAGGCCGC GCACCGCCCC GGCCACACCG CCCTGATCCT GGAAGAACGG       120
     AGCCTGGACT ACGCCGCGCT GTGCGCGGGC ATGGACCGGG TGGCGCGCAG CCTGCAGCAG       180
     GGCGGCCTGG GGCCCGGCGA CGTGGTGGCC GTCTGCGCCG GCACCTCGGT CGAGTACCTG       240
     CTGGCCTACC TCGGCGCGCT GCGCGCCGGC GTGGCGGTGG CACCGCTGGC GCCCTCGGCC       300
     ACGGCCGAGC ACCTGAGCGC CATGCTGGAC AACTGCGGCG CGCGCCTGGT GCTGCGCGAC       360
     CGCGAGGTCG CCGCGCAATG GCCCCTGCAC GCGGGCGCTG TGCTGCGCTG CGTGGCGCTG       420
     GACGATGCGC CCGAGGCCGG CGAGCCCTGG TCGCAATGGC TGGCGCAGGG CGGCGGCGCG       480
     CCCGCGCCGA TCGCGCCCGC GCCCGACTGG GCCTTCAACG TGATCTACTC GTCGGGCACC       540
     ACGGGCGTGC CCAAGGGCAT CGTGCAGTCC TGGGCCATGC GCTGGGCCCA TGTGCGCCGC       600
     GCCGTCACCA ACGGCTACGG CCCTGATGCC GTCTCGCTGT GCGCCACGCC GCTGTATTCC       660
     AACACCACGC TGGTGGCGGC TCTGCCTACG CTGGCACTGG GCGGCACGCT GGTGCTGATG       720
     CGCAAGTTCG ACGCCGCGCA TTACCTGGAG CTGGCCGAGC GGCACGGCGC CACCCACACC       780
     ATGCTGGTGC CCGTGCAGTA CCAGCGCCTC ATGGCCTGCC CCGCGTTCGA CGGCACCGAC       840
     CTGAGCCGGC TGCGGCACAA GTTCTGCACC AGCGCGCCCT TCGGCGCCGC CCTCAAGGCC       900
     GAGGTGCTGC GGCGCTGGCC CGGCCGGCTC ATCGAGTACT ACGGCCTGAC CGAGGGCGGC       960
     GTGCGCTGCG AGCTGCACTG CCACGACTTC CCGCACAAGC TGCACACCGT GGGCCGCCCC      1020
     GGCGAGGGCG CCGACATCCG CTTCATCGAC GAGCAGGGGC GCGAGCTGCC GCCCGGCGCG      1080
     CAGGGCGAGA TCGTCGGCCG CTCGGCCGGC ATGATGAGCG GCTACCACCG CCTGCCCGAC      1140
     AAGACGCGCG AGGCCGAGTG GTTCGACGCC CAGGGCCAGC GCTTCATCCG CAGCGGCGAC      1200
     GTGGGCCGGC TCGACGAGGA CGGCTTCATC GTGCTCGGCG ACCGCATGAA GGACATGATC      1260
     ATCACGGGCG GCTTCAACGT CTATCCGAGC GACATCGAGG GCGTGCTGCA GCAGCACCCG      1320
     CAGGTGGCCG AATGCGCGGT GGTCGGCGTG CCTTCCGAGC AATGGGGCGA GACCCCCGTG      1380
     GCCTATGTGG TGCCGCGCGC CGGCGCGCAG CCCGGCGCGC GGGAGCTGCG CGAATGGCTC      1440
     AACGCCCGCG TGGGCAAGAC CCAGCGCGTG GCCGACCTGC GGCTGGCCGA GCGCCTGCCG      1500
     CGCAGCGAGA TCGGCAAGGT GCTCAAGCGC GAGCTACGCG AGCAGTACCT GCGGGCGAAC      1560
     CCCGCGGCCC ATTGA                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page