(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE133

ALDEN1_2.PE133       Location/Qualifiers
FT   CDS_pept        149285..150277
FT                   /locus_tag="Alide_0134"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0099"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0099 hypothetical protein"
FT                   /db_xref="GI:319760871"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102157"
FT                   /translation="MPIRPSRPRRAMLAGLALGAGALLAPAAQAADAWPAKPIQLVIPY
FT                   PPGGSADLLGRPLAVQLQQQLGQPVVLEYKPGAGGTLATQYLARAKPDGYTVLMVLAAH
FT                   AINDSLYPKLPYDTRKDFAPVSLVANLPMVVAASAKLQARNIQELVQAAKAAPGKLTFG
FT                   SAGNGNTGHLAAEYFSSIAGVKMTHVPYKGSAGVVNAMLAGDIDLTFDSISTSMPHIRS
FT                   GRMHALAVTSAQRSALAPEVATVQEQGIPGFEVTGWYALIAPAGTPPDIRQRLAREIAA
FT                   ALRQPQLQSQLAAGGYEPVGSTPEALQAHIDSEIARWAAVVKSTGAKVD"
FT                   /protein_id="YP_004124808.1"
     ATGCCCATCC GTCCCTCGCG GCCGCGCCGC GCCATGCTCG CCGGCCTGGC GCTGGGTGCC        60
     GGTGCCCTGC TTGCGCCCGC CGCCCAGGCC GCCGACGCCT GGCCCGCCAA GCCGATACAG       120
     CTCGTGATTC CCTACCCGCC CGGCGGCAGC GCCGACCTGC TGGGCCGGCC GCTGGCCGTG       180
     CAGCTGCAGC AGCAACTGGG CCAGCCCGTG GTGCTCGAAT ACAAGCCCGG CGCGGGCGGC       240
     ACGCTGGCCA CGCAGTACCT GGCGCGCGCC AAGCCCGACG GCTACACGGT GCTCATGGTG       300
     CTGGCCGCCC ATGCGATCAA CGACAGCCTG TACCCCAAGC TGCCCTACGA CACGCGCAAG       360
     GACTTCGCGC CCGTGTCGCT GGTGGCCAAC CTGCCCATGG TGGTGGCCGC CAGCGCCAAG       420
     CTGCAGGCCA GGAACATCCA GGAGCTGGTG CAGGCCGCCA AGGCGGCGCC CGGCAAGCTC       480
     ACCTTCGGCT CGGCAGGCAA CGGCAACACC GGGCACCTGG CGGCCGAGTA CTTCAGCAGC       540
     ATCGCCGGCG TGAAAATGAC GCATGTACCC TACAAGGGCA GCGCCGGCGT GGTCAACGCC       600
     ATGCTGGCCG GCGACATCGA TCTGACCTTC GACAGCATCT CCACCTCCAT GCCGCACATC       660
     CGCAGCGGCC GCATGCACGC GCTGGCCGTC ACCAGCGCGC AACGCTCGGC GCTGGCGCCC       720
     GAGGTGGCGA CGGTGCAGGA GCAGGGCATA CCCGGCTTCG AGGTGACGGG CTGGTACGCG       780
     CTCATCGCGC CGGCCGGCAC GCCGCCCGAT ATCAGGCAGC GCCTCGCCCG GGAAATCGCC       840
     GCGGCCCTGC GCCAGCCCCA GCTGCAGTCG CAGCTGGCCG CCGGTGGCTA CGAGCCCGTG       900
     GGCTCCACGC CCGAGGCGCT GCAGGCGCAC ATCGACAGCG AGATCGCCCG CTGGGCCGCC       960
     GTGGTCAAGT CCACCGGCGC CAAGGTGGAC TGA                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page