(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE134

ALDEN1_2.PE134       Location/Qualifiers
FT   CDS_pept        150290..150745
FT                   /locus_tag="Alide_0135"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dia:Dtpsy_0117 thioesterase superfamily protein"
FT                   /db_xref="GI:319760872"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102158"
FT                   /translation="MQHHSIAINDIPPSPFAGEPPDMFFGLPMAMARAMALRGERIGND
FT                   MAQVRLGFQPDQANSRGDVHGGSIATLLDCTLAAAVRSHDPAAYGVATIDLTLHFVTAA
FT                   GGDLIATAHCERRGRSISFARGEVRAEDGTLVALATGSFKLIARRQD"
FT                   /protein_id="YP_004124809.1"
     ATGCAACACC ATTCCATCGC CATCAACGAC ATCCCCCCGA GCCCCTTCGC CGGCGAGCCG        60
     CCCGACATGT TCTTCGGCTT GCCCATGGCC ATGGCGCGCG CCATGGCGCT GCGCGGCGAG       120
     CGCATAGGCA ACGACATGGC CCAGGTGCGC CTGGGTTTCC AGCCGGACCA GGCCAACAGC       180
     CGCGGCGACG TGCATGGTGG CTCGATCGCC ACGCTGCTCG ACTGCACCCT GGCGGCGGCC       240
     GTGCGCTCGC ACGACCCTGC CGCCTATGGC GTGGCCACCA TCGACCTGAC GCTGCACTTC       300
     GTGACCGCCG CCGGCGGCGA CCTGATCGCC ACCGCCCACT GCGAGCGGCG CGGCCGCTCC       360
     ATCAGCTTCG CGCGCGGCGA GGTGCGCGCG GAGGACGGTA CCCTGGTGGC GCTGGCCACC       420
     GGAAGCTTCA AGCTGATCGC GCGCCGGCAG GACTGA                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page