(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE135

ALDEN1_2.PE135       Location/Qualifiers
FT   CDS_pept        complement(150767..151777)
FT                   /locus_tag="Alide_0136"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0118"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0118 hypothetical protein"
FT                   /db_xref="GI:319760873"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102159"
FT                   /translation="MAHDTPLARCSRRQLLAMAAGAAAAGPLHAQAQAGFATRPVRVVV
FT                   PFAAGGATDVITRVLGEHMARRFGQPVVVDNKPGAAGLIAGEAVVKSAPDGMTALLGTT
FT                   STMLTNKYLYQKTAYDPLTDLTPLVRVCLAPIALVVSADVPARNMQEFMAWIRANKGRL
FT                   SYGSYGIGSHGQLACATLSDIAGADMSHVAYKGEAPMVQDLLGGQIKMGMGSLLSLKAH
FT                   IDAGKLRALAMTGPRRVPLLPDVPTFAEAGYPQDALALVGWLAIAGPKGMPAQVARQWA
FT                   EAANQAVASRDGMARIIAAGFVPVDDDTPEKFARLWAQEAPIWGRLLQAAGVQPT"
FT                   /protein_id="YP_004124810.1"
     atggcacacg acacccccct tgcacgctgc agccgccgcc agttgctggc catggcggct        60
     ggcgccgcgg ccgccgggcc gctccacgcg caggcccagg ctggcttcgc cacccgcccg       120
     gtgcgggtgg tggtgccgtt cgccgcgggc ggcgccaccg acgtcatcac ccgcgtactg       180
     ggcgagcaca tggccaggcg cttcggccag cccgtggtgg ttgacaacaa gcccggcgcg       240
     gccggcctga tcgcgggcga ggcggtggtc aagtcggcgc ctgacggcat gacggcgctg       300
     ctgggcacca cctcgaccat gctgaccaac aaatacctct accagaagac cgcctacgac       360
     ccgctgaccg atctcacccc gctggtgcgc gtgtgcctgg cgccgatcgc cctggtggtc       420
     tcggccgacg taccggcccg gaacatgcag gagttcatgg cctggatccg cgccaacaag       480
     ggcaggctgt cctacggctc ctacggcata ggctcgcacg gccagctcgc ctgcgccacg       540
     ctcagcgaca tcgcgggcgc cgacatgtcg cacgtggcct acaagggcga ggcgccgatg       600
     gtgcaggacc tgctgggcgg ccagatcaag atgggcatgg gcagcctgct gtcgctcaag       660
     gcgcacatcg atgccggcaa gctgcgcgcg ctggcgatga ccggcccgcg ccgcgtgccc       720
     ctgctgcccg acgtgcccac cttcgccgag gccggctacc cgcaggacgc gctggccctc       780
     gtcggctggc tggcaatcgc cggccccaag ggcatgccgg cgcaagtggc ccgccagtgg       840
     gccgaggccg ccaaccaggc ggtggccagc cgcgacggca tggcgcgcat catcgccgcc       900
     ggcttcgtgc ccgtagacga cgacacgccc gagaaattcg cccgcctgtg ggcgcaggag       960
     gcgccgatct ggggccgcct gctgcaggcg gcgggcgtgc agccgacctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page