(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE137

ALDEN1_2.PE137       Location/Qualifiers
FT   CDS_pept        complement(152836..153990)
FT                   /locus_tag="Alide_0138"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0103 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760875"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102161"
FT                   /translation="MQDLIQRTIYREDHEQFREQARRFFDKEIVPFHAQWERDGIVPKE
FT                   VWRKAGREGLLNTMLPEPYGGGGDFGHAAILIEEVARTGASGLGFPLHSDIVAPYILAY
FT                   GSTEQKDRWLPRMAAGELIGAIAMTEPGAGSDLKSVRTTARLVKDSEGDHYILNGSKTF
FT                   ITNGINSEIVIVVAKTSPELGAKGVSLIVVEEGTPGFSKGRKLEKIGLMAQDTSELFFD
FT                   NVKVPVGNLLGEENMGFKYLMKELAQERLVVAVRAAASIEAFLQKTVDYTRERKAFGQT
FT                   VFEFQNTRFKLAEAKAQATMLRVFVDDCMRLHMQRQLTPERAAMVKLNATALQNRLLDE
FT                   FLQLHGGYGYMTEYQVGRAWTDARIGRIYGGSDEIMKEIIARTL"
FT                   /protein_id="YP_004124812.1"
     atgcaagacc tgatccagcg caccatctac cgcgaggacc atgaacaatt ccgcgagcag        60
     gcgcggcgct tcttcgacaa ggaaatcgtg cccttccacg cccagtggga gcgcgacggc       120
     atcgtgccca aggaagtctg gcgcaaggcc gggcgcgagg gcctgctcaa caccatgctg       180
     cccgagccct acggcggcgg cggcgacttc ggccacgcgg ccatccttat cgaggaagtt       240
     gcgcgcaccg gcgccagcgg cctgggcttt ccgctgcact cggacatcgt cgcgccctac       300
     atcctggcct acggcagcac cgagcagaag gaccgctggc tgccgcgcat ggccgcgggc       360
     gagctaatcg gcgccatcgc catgaccgag cccggcgcgg gcagcgacct gaagtcggtg       420
     cgtaccacgg ccagattggt gaaggacagc gagggcgacc actacattct caacggcagc       480
     aagaccttca tcaccaacgg catcaacagc gagatcgtca tcgtcgtcgc caaaaccagc       540
     cccgaactgg gcgccaaggg cgtgtcgctg atcgtggtgg aggagggcac gccgggcttc       600
     agcaagggcc gcaagctgga gaagatcggc ctgatggcgc aggacacctc cgagctgttc       660
     ttcgacaacg tcaaggtacc cgtgggcaac ctgctgggcg aggagaacat gggcttcaaa       720
     tacctgatga aggagctggc gcaggagcgt ctggtggtcg ccgtgcgcgc cgccgcctcc       780
     atcgaggcct tcctgcagaa gaccgtggac tacacgcgcg agcgcaaggc cttcggccag       840
     acggtgttcg agttccagaa cacgcgcttc aagctcgccg aggccaaggc ccaggccacc       900
     atgctgcgcg tgttcgtgga cgactgcatg cggctgcaca tgcagcgcca gctcacgccc       960
     gagcgcgccg ccatggtcaa gctcaacgcc acggcgctgc agaaccgcct gctcgacgaa      1020
     ttcctgcagc tgcacggcgg ctacggctac atgaccgaat accaggtggg ccgcgcctgg      1080
     accgatgcgc gcatcggccg catctacggc ggcagcgacg agatcatgaa agagatcatc      1140
     gcccgcaccc tgtaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page