(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE138

ALDEN1_2.PE138       Location/Qualifiers
FT   CDS_pept        complement(154066..155613)
FT                   /locus_tag="Alide_0139"
FT                   /gene_family="HOG000229987" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0104 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760876"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102162"
FT                   /translation="MQDFFGRAQAAPERVVVFMADQGRSYTAGALAQMAQQMAQWLAAQ
FT                   GLQTGERFAVLLENRVEILALVLAARQAGLYAAVLSTHLTADEVAYIVGDSGARLVVAS
FT                   DKTLSQLQGIGLPCWTVDEARPQAPSLHAALAALQGPPVDFADRPLGRDLLYSSGTTGR
FT                   PKGVLKALWPAELRGQADPEAVSTARLLGMGEDTVYLSPAPLYHAAPLRYTLRALELGG
FT                   RAVIMERFDAENALALIERYRVTHSQWVPTMFGRLLKLPAQVRQRHDLSSHHMAIHAAA
FT                   PCPVDVKRAMLDWWGDILMEYYAGSEGCGTTMIDSTEWRLRPGSVGRPTTGRLHIVDDE
FT                   GRELPAGEIGQVYFSGGGQFTYLNDPEKTRQAINDRGWVTYGDIGHVDAEGYLFLSDRR
FT                   ADLILSGGVNLYPQEIENALARHPGVQEVAVVGVPHPDFGEVPLAAVVLHPGQEATPET
FT                   ARAIAARAAEVLARLKLPQRMVFVDALPRLETGKLLRRQLKERFREQPQAGFALRDS"
FT                   /protein_id="YP_004124813.1"
     atgcaggatt tctttggccg cgcacaggcg gcccccgaac gggtggtggt gttcatggcc        60
     gaccagggcc gcagctacac cgccggcgcg ctggcgcaga tggcgcagca gatggcgcag       120
     tggctcgcgg cccaggggct gcagacaggc gagcgcttcg cggtgctgct ggagaaccgc       180
     gtcgagatcc tggccctggt gctggccgcg cgccaggcgg gcctgtatgc ggccgtgctc       240
     agcacccacc tgacggcgga tgaggtggcc tacatcgtgg gcgacagcgg cgcgcgcctg       300
     gtggtggcat ccgacaagac gctgtcccag ctccagggca tcggcctgcc ctgctggacc       360
     gtggacgagg cccggccgca ggccccgtcg ctgcacgcgg cgctggcggc gctgcagggc       420
     ccgccggtgg acttcgccga ccggccgctg gggcgcgacc tgctgtattc ctccggcacc       480
     acgggccggc ccaagggcgt gctcaaggcc ctgtggcccg ccgagctgcg cggccaggcc       540
     gaccccgagg ccgtgagcac cgcccgcctc ctgggcatgg gcgaggacac ggtgtacctc       600
     tcgcccgcgc cgctgtacca cgccgcgccg ctgcgctaca cgctgcgcgc gctcgagctc       660
     ggcgggcggg ccgtgatcat ggagcgcttc gacgcggaaa acgccctggc gctcatagag       720
     cgctaccgcg tcacccacag ccagtgggtg cccaccatgt tcggccgcct gctcaagctg       780
     cccgcgcaag tgcgccagcg ccacgacctg tcgagccacc acatggccat ccacgccgcc       840
     gcgccctgcc cggtggatgt caaacgcgcc atgctcgact ggtggggtga cattctgatg       900
     gagtactacg ccggctcgga gggctgcggc acgaccatga tcgattcgac cgagtggcgc       960
     ctgcgccccg gctcggtggg ccggcccacc acgggccggc tgcacatcgt ggacgacgag      1020
     ggccgggaac tgcccgcggg cgagatcggc caggtgtatt tctcgggcgg cgggcagttc      1080
     acctacctga acgaccccga gaagacgcgc caggccatca acgaccgcgg ctgggtcacg      1140
     tacggcgaca tcggccacgt ggacgccgag ggctacctct tcctgagcga ccggcgcgcc      1200
     gacctgatcc tctcgggcgg cgtcaacctc tacccgcagg agatagaaaa cgccctggcc      1260
     cgccaccccg gcgtgcagga ggtggccgtg gtcggcgtgc cccaccccga cttcggcgag      1320
     gtgccgctag cggccgtggt gctgcacccg ggccaggagg ccacgccgga aacggcgcgc      1380
     gccatcgccg cgcgggccgc cgaggtgctg gcccggctca agctgccgca gcgcatggtg      1440
     ttcgtcgatg cgctgccgcg cctggagacc ggcaagctgc tgcggcgcca gctcaaggag      1500
     cggttccgcg agcaaccgca ggccggattc gccctgcggg actcataa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page