(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE139

ALDEN1_2.PE139       Location/Qualifiers
FT   CDS_pept        155819..156997
FT                   /locus_tag="Alide_0140"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.16"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   dia:Dtpsy_0122 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="GI:319760877"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="GeneID:10102163"
FT                   /translation="MKNPVIVDAIRSPMARAKPDGALAQLHPVDLLSQVLQQLVERNKI
FT                   DPGSVDDVICGCVSQSGEQANTPGRLAWLAAGLPMHVPSTTIDRKCGSSQQAVHFAAQA
FT                   IMAGVQDIVIACGVESMSRVPMGSSRMGKNTTGARFDALYAPGLVGQGVSADLVAAKWG
FT                   LGRTELDAYAARSHQRAHAAQAGGGFAREIVGMDTPAGRVAQDETIRAGTTVEKLAGLK
FT                   AVFETEELSARFPQIQWNTTAGNASQMTDGAAAMLIMSEERALQLGLTPRARFVAFDVV
FT                   GDDPLYMLTAPIPATQRVLAKARMKLDDIHHYEINEAFASVPMAWQKELKADGERLNPR
FT                   GGAIALGHPLGASGIRLMTTMLHALEDSGQRYGLQSMCEAGGMANATIIERL"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_004124814.1"
     ATGAAAAATC CCGTCATCGT CGATGCCATC CGCAGCCCCA TGGCCCGGGC CAAGCCCGAT        60
     GGCGCGCTGG CCCAGCTGCA CCCCGTGGAT CTGCTCTCGC AGGTGCTGCA GCAGCTGGTG       120
     GAACGTAACA AGATCGATCC CGGCAGCGTG GACGACGTGA TCTGCGGCTG CGTGAGCCAG       180
     TCCGGCGAGC AGGCCAACAC CCCCGGGCGC CTGGCCTGGC TGGCCGCGGG CCTGCCCATG       240
     CACGTGCCCT CCACCACCAT CGACCGCAAG TGCGGGTCGA GCCAGCAGGC CGTGCACTTC       300
     GCGGCCCAGG CCATCATGGC CGGCGTGCAG GACATCGTCA TCGCCTGCGG CGTGGAGTCG       360
     ATGAGCCGCG TGCCCATGGG CAGCTCGCGC ATGGGCAAGA ACACCACCGG CGCGCGCTTC       420
     GATGCGCTCT ACGCGCCCGG CCTGGTGGGC CAGGGCGTGT CGGCCGACCT CGTCGCCGCC       480
     AAGTGGGGCC TGGGCCGCAC CGAGCTCGAC GCGTATGCGG CGCGCTCGCA CCAGCGCGCC       540
     CATGCGGCGC AGGCGGGCGG CGGCTTCGCG CGCGAGATCG TGGGCATGGA CACGCCCGCC       600
     GGCCGCGTGG CGCAGGACGA GACGATCCGC GCCGGCACCA CGGTGGAAAA GCTCGCCGGC       660
     CTCAAGGCCG TGTTCGAGAC AGAGGAGCTG TCGGCGCGCT TTCCGCAGAT CCAGTGGAAC       720
     ACCACGGCGG GCAACGCCTC GCAGATGACC GACGGCGCGG CCGCCATGCT GATCATGAGC       780
     GAGGAGCGTG CGCTGCAGCT CGGCCTGACC CCGCGCGCGC GCTTCGTGGC CTTCGACGTG       840
     GTGGGCGACG ACCCGCTGTA CATGCTCACC GCCCCCATCC CCGCCACCCA GCGCGTGCTG       900
     GCCAAGGCGC GCATGAAGCT CGACGACATC CACCACTACG AGATCAACGA GGCCTTCGCC       960
     TCGGTGCCCA TGGCCTGGCA GAAGGAGCTA AAGGCCGACG GCGAGCGCCT GAACCCGCGC      1020
     GGCGGCGCCA TCGCCCTGGG CCACCCGCTG GGCGCCTCGG GCATCCGCCT GATGACCACG      1080
     ATGCTGCACG CCCTGGAAGA CAGCGGCCAG CGCTACGGCC TGCAGTCCAT GTGCGAGGCC      1140
     GGCGGCATGG CCAACGCCAC CATCATCGAA CGACTTTGA                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page