(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE140

ALDEN1_2.PE140       Location/Qualifiers
FT   CDS_pept        157053..157820
FT                   /locus_tag="Alide_0141"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ajs:Ajs_0106 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760878"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102164"
FT                   /translation="MKLQQGMTALVTGGVSGLGEASAIALLERGLQVVAVDLNDERGQA
FT                   MEKQYAGRLRYVKADVSDEAQMQQAIAAAEAFGNFRALVHCAGIGGPVRLVEKDGSPGS
FT                   LEKYVNIIRVNQIGTFNTLRLAAASMARNEPVDGERGACVLTASVAGYEGQIGQIPYAS
FT                   SKAGVIGMTIVAARDLASKFIRVCTIAPGLFDTPILAKLPENVRQSLAASVPHPARLGH
FT                   PAEYAMTALHILENPMLNGETIRLDGAIRMQPR"
FT                   /protein_id="YP_004124815.1"
     ATGAAACTGC AACAAGGAAT GACCGCCCTG GTCACCGGCG GCGTCTCGGG CCTGGGCGAG        60
     GCCTCGGCCA TCGCGCTGCT CGAGCGCGGC CTTCAAGTGG TCGCCGTGGA CCTGAACGAC       120
     GAGCGCGGCC AGGCCATGGA AAAGCAATAC GCCGGCCGCC TGCGCTACGT GAAGGCCGAC       180
     GTTTCCGACG AGGCCCAGAT GCAACAGGCC ATCGCGGCGG CCGAGGCCTT CGGCAACTTC       240
     CGCGCGCTGG TGCACTGCGC CGGCATCGGC GGGCCCGTGC GCCTGGTCGA GAAGGACGGC       300
     AGCCCCGGCT CGCTGGAGAA GTACGTGAAC ATCATCCGCG TGAACCAGAT CGGCACCTTC       360
     AATACGCTGC GCCTGGCCGC CGCGAGCATG GCCAGGAACG AGCCCGTCGA TGGCGAGCGC       420
     GGCGCCTGCG TGCTCACCGC CTCGGTGGCG GGCTACGAGG GGCAGATCGG CCAGATACCC       480
     TACGCCTCGT CCAAGGCCGG CGTGATCGGC ATGACCATCG TCGCGGCGCG CGACCTGGCG       540
     TCCAAGTTCA TCCGCGTGTG CACCATCGCG CCGGGCCTGT TCGACACGCC CATCCTGGCC       600
     AAGCTGCCCG AGAACGTGCG CCAGTCGCTG GCCGCCTCCG TGCCTCATCC GGCGCGCCTG       660
     GGCCACCCCG CGGAATACGC GATGACCGCG CTGCACATCC TGGAGAACCC CATGCTCAAC       720
     GGCGAGACCA TCCGCCTGGA TGGCGCCATC CGCATGCAGC CACGGTGA                    768
//

If you have problems or comments...

PBIL Back to PBIL home page