(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE141

ALDEN1_2.PE141       Location/Qualifiers
FT   CDS_pept        157889..158887
FT                   /locus_tag="Alide_0142"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0125"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="GI:319760879"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102165"
FT                   /translation="MPPCNRRRALHLTGACALLALGALATAPAARADAAWPTRPITFVI
FT                   PGAAGGTTDTPARFMAQKLGERLGQPIVVDNKPGAGGMLGAGLVARAQPDGYTVLVGNT
FT                   GSNAINYSAYQKLGYKPDDFIALTDMISFANVLVVPVKSPIKSLGELVAAAKKEPGKLA
FT                   FSSAGVGQTTHLMGELLRQRAGVDVVHVPYKGSAPATMAIVSGETQFMFDNLTGSLAHV
FT                   KDGKLRALAVTGATREPELPDVPTMTELGMRDFDKVGWMGFFLPAKTPPEIVKKLTDNL
FT                   VAVLKDPAVVQRYRELGGRPGGMASAQFSQMVERDRKDWGELIRSQKLQLD"
FT                   /protein_id="YP_004124816.1"
     ATGCCCCCGT GCAACCGCCG CCGCGCGCTC CATCTGACCG GGGCATGCGC CCTGCTGGCG        60
     CTGGGCGCCC TGGCGACGGC CCCGGCCGCC CGGGCCGATG CCGCCTGGCC AACGCGCCCC       120
     ATCACCTTCG TCATCCCCGG CGCCGCCGGC GGCACCACCG ACACGCCGGC GCGCTTCATG       180
     GCGCAAAAGC TGGGCGAGCG CCTGGGCCAG CCCATCGTGG TGGACAACAA GCCCGGCGCG       240
     GGCGGCATGC TGGGCGCCGG CCTGGTGGCG CGCGCCCAGC CCGACGGCTA CACCGTGCTG       300
     GTGGGCAACA CCGGCTCCAA CGCCATCAAC TACAGCGCCT ACCAGAAGCT CGGCTACAAG       360
     CCGGACGACT TCATCGCGCT GACCGACATG ATCTCGTTCG CCAACGTGCT GGTGGTGCCG       420
     GTGAAGTCGC CCATCAAGAG CCTGGGCGAG CTGGTCGCGG CCGCGAAGAA GGAGCCGGGC       480
     AAGCTGGCGT TTTCGTCGGC GGGCGTGGGC CAGACCACGC ACCTGATGGG CGAGCTGCTG       540
     CGCCAGCGCG CGGGGGTGGA CGTGGTCCAC GTGCCCTACA AGGGCTCCGC GCCGGCCACC       600
     ATGGCCATCG TGTCCGGCGA GACCCAGTTC ATGTTCGACA ACCTCACGGG CTCGCTCGCC       660
     CACGTCAAGG ACGGCAAGCT GCGCGCGCTG GCCGTGACCG GCGCCACGCG CGAGCCCGAG       720
     CTGCCCGACG TGCCCACCAT GACCGAGCTG GGCATGAGGG ACTTCGACAA GGTAGGCTGG       780
     ATGGGCTTCT TCCTGCCCGC CAAAACGCCC CCGGAGATCG TGAAGAAGCT CACCGACAAC       840
     CTGGTCGCCG TACTCAAGGA CCCGGCCGTG GTCCAGCGCT ACCGCGAGCT CGGCGGCCGC       900
     CCCGGCGGCA TGGCGAGCGC GCAGTTCTCG CAGATGGTGG AGCGCGACCG CAAGGACTGG       960
     GGCGAGCTCA TCCGCAGCCA GAAGCTGCAG CTCGATTGA                              999
//

If you have problems or comments...

PBIL Back to PBIL home page