(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE142

ALDEN1_2.PE142       Location/Qualifiers
FT   CDS_pept        158897..159703
FT                   /locus_tag="Alide_0143"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ajs:Ajs_0109 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760880"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102166"
FT                   /translation="MTDTSSFAGRHVFVAGGSSGINLGIAQAFARAGAHVTVMSRSPDK
FT                   VQQAAEGLRALGAQALGISADVRDSAAVDAALRQSHALFGDIDVLVSGAAGNFIAPAKD
FT                   LSPNGFRTVIDIDLNGSFHVLRLAYPLLRKPGASVINISAPQGVNPTMYQVHACAAKAG
FT                   IDMMTRVLAMEWGEDGVRVNAIAPGPIADTEGMRRLAPSPEALANAVASVPLQRMGTLE
FT                   DIAHMALFLSSPQAGYVTGAVIPVDGGSSLRGGRDMRASYTPRGAA"
FT                   /protein_id="YP_004124817.1"
     ATGACTGACA CCTCCTCCTT CGCGGGCCGC CATGTGTTCG TGGCCGGCGG CAGCAGCGGC        60
     ATCAACCTCG GCATCGCGCA GGCGTTCGCG CGCGCGGGCG CCCATGTCAC GGTCATGAGC       120
     CGCTCGCCCG ACAAGGTGCA GCAGGCGGCC GAAGGGCTGC GCGCTCTGGG CGCGCAGGCG       180
     CTGGGCATCA GCGCCGACGT GCGCGACAGC GCCGCGGTGG ACGCGGCGCT GCGCCAGTCG       240
     CACGCCCTGT TCGGCGACAT CGACGTGCTC GTCTCCGGCG CGGCGGGCAA CTTCATCGCG       300
     CCGGCCAAGG ACCTGTCGCC CAACGGCTTC AGGACGGTGA TCGACATCGA CCTCAACGGC       360
     AGCTTCCACG TGCTGCGCCT GGCCTACCCG CTGCTGAGGA AGCCCGGCGC CAGCGTCATC       420
     AACATCTCGG CGCCCCAGGG CGTCAACCCC ACCATGTACC AGGTGCACGC CTGCGCCGCC       480
     AAGGCCGGCA TCGACATGAT GACGCGCGTG CTGGCCATGG AATGGGGTGA GGATGGCGTG       540
     CGCGTGAACG CCATCGCGCC CGGCCCGATC GCCGACACCG AAGGCATGCG CCGCCTCGCG       600
     CCCTCGCCCG AGGCGCTGGC CAACGCGGTC GCCAGCGTGC CGCTGCAGCG CATGGGAACG       660
     CTGGAGGACA TCGCCCACAT GGCGCTGTTC CTGTCCTCGC CGCAGGCCGG CTACGTGACG       720
     GGCGCCGTCA TCCCCGTGGA CGGTGGCTCC TCGCTGCGCG GCGGGCGGGA CATGCGCGCC       780
     TCCTACACCC CGCGGGGCGC GGCATGA                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page