(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE144

ALDEN1_2.PE144       Location/Qualifiers
FT   CDS_pept        159841..160620
FT                   /locus_tag="Alide_0145"
FT                   /gene_family="HOG000256786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0128 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760882"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102168"
FT                   /translation="MNTDADGKLVSALVRGISILRCFGHKRTELSARELMELTGLPKPT
FT                   LFRLTDTLCELGLLRYSERLSKYVPGLGLLQLSSPVLTRMALRQFARPLMQSLADLTEG
FT                   QVQLGVGHKRELCLVELANGMGNSVYRPEIGVRMSLSRTATGRAYLLGMADDAREAYLQ
FT                   DLQASDPQRAAWLAQRLVNAREDMERHGFCRSHGDLHSEIESIAVPMSQPQDGELWIFA
FT                   VSVPVFSPLYDRLESDLGPRLRTLVRSVEAVVGAGVP"
FT                   /protein_id="YP_004124819.1"
     GTGAATACGG ATGCGGACGG CAAACTGGTC AGTGCCCTGG TGCGCGGCAT TTCCATCCTG        60
     CGCTGCTTCG GCCACAAGCG TACCGAGCTC AGCGCGCGCG AGCTGATGGA GCTCACCGGC       120
     CTGCCCAAGC CGACGCTGTT TCGCCTGACC GACACCTTGT GCGAACTCGG GCTGCTGCGC       180
     TATTCGGAGC GCCTGTCCAA ATACGTGCCG GGCCTGGGCC TGCTGCAGCT GTCCTCGCCG       240
     GTGCTCACGC GCATGGCGCT GCGCCAGTTC GCACGGCCCC TGATGCAGTC GCTGGCCGAC       300
     CTGACTGAAG GCCAGGTGCA ACTGGGCGTG GGCCACAAGC GCGAGCTGTG CCTGGTGGAG       360
     CTGGCCAACG GCATGGGCAA CAGCGTCTAC CGGCCCGAGA TCGGCGTGCG CATGTCGCTG       420
     TCGCGCACCG CCACGGGCCG CGCCTACTTG CTGGGCATGG CGGACGACGC GCGCGAGGCC       480
     TACCTGCAGG ACCTGCAGGC CAGCGACCCG CAGCGCGCCG CCTGGCTGGC GCAGCGCCTG       540
     GTCAACGCCC GCGAGGACAT GGAGCGCCAC GGCTTTTGCC GCAGCCACGG TGATCTGCAC       600
     AGCGAGATCG AATCCATCGC CGTGCCCATG AGCCAGCCCC AGGACGGCGA GCTGTGGATC       660
     TTCGCGGTCT CGGTGCCGGT GTTCAGCCCG CTGTACGACA GGCTGGAGTC CGACCTGGGC       720
     CCGCGCCTGC GTACCCTGGT GCGCTCGGTC GAGGCCGTGG TGGGTGCGGG CGTGCCCTGA       780
//

If you have problems or comments...

PBIL Back to PBIL home page