(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE146

ALDEN1_2.PE146       Location/Qualifiers
FT   CDS_pept        complement(161850..162839)
FT                   /locus_tag="Alide_0147"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_B1448"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_B1448 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760884"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102170"
FT                   /translation="MSHPFCHIVPLRRRSVLLGGAALLGMLSSPAWSQEVARIYVGFAA
FT                   GGVTDLAARLLAPALSAELGQTFIVENRPGASSALAIKAVEGSAPASHTFVLYPTLALL
FT                   GFLLNGQQPALDRITPISLLYEQFAVLAINPQVAGLENVRTLQDLLQVAKAKAGTLTYT
FT                   SSGVGSTGHLAMEWVCSLAGVKMQHVPYKGGAPAVTDVLGGHVGTIFADSTIIAPHVKS
FT                   GKVRALAINYPVRVPGFAEVPTVAEQGFKEVSAVPWVVLAGPPGMSDAAADRMAAAVSR
FT                   VLAKPDIAQSMQEQNMVPRHSTPRETRQLMQRDMLAWRKIIEDNGIKL"
FT                   /protein_id="YP_004124821.1"
     atgtcccatc cgttttgcca tatcgtgccc ctgcgccggc gctccgtgct gctcgggggc        60
     gccgccctgc tgggcatgct ctccagtccg gcctggagcc aggaggtcgc acgcatctat       120
     gtgggctttg ccgctggcgg cgtgaccgat ctggcggccc ggctgctggc gccggcgctg       180
     tcggcggagc tgggccagac cttcatcgtg gaaaaccggc cgggcgcatc gagcgcgctc       240
     gccatcaagg ccgtggaggg cagcgcgcca gccagccaca ccttcgtgct ctaccccacg       300
     ttggcgctgc tgggctttct actgaacggg cagcagcccg cgctcgacag gatcacgccg       360
     atctcgctgc tgtacgagca attcgccgtg ctggccatca acccgcaggt ggctggcctg       420
     gagaacgtgc gcacgctgca ggacctgctg caggtggcca aggcgaaggc gggcacgctg       480
     acctatacca gttcgggcgt tggcagcacc gggcatctgg ccatggaatg ggtctgcagc       540
     ctggccggcg tcaagatgca gcatgtgcct tacaagggcg gagcgcctgc ggtgaccgat       600
     gtactgggcg ggcatgtcgg cacgatcttt gccgattcca cgatcattgc gccccatgtc       660
     aagtcgggca aggtgcgtgc cctggccatc aactacccag tgcgcgtgcc aggcttcgcc       720
     gaggtgccca cggtggcgga gcagggcttc aaggaggtct cggccgtgcc ctgggtcgtt       780
     ctggccggcc cgcccggcat gtccgatgct gcggccgacc ggatggctgc cgccgtgagc       840
     cgcgtgctgg ccaagcccga catcgcccag tccatgcagg aacagaacat ggtgcccagg       900
     cactcgacgc cccgggaaac ccggcagctc atgcagcgcg acatgctggc ctggcgcaag       960
     atcatcgagg acaacggcat caagctgtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page