(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE147

ALDEN1_2.PE147       Location/Qualifiers
FT   CDS_pept        complement(162883..163299)
FT                   /locus_tag="Alide_0148"
FT                   /gene_family="HOG000229752" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   reh:H16_A2147 hypothetical protein"
FT                   /db_xref="GI:319760885"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="GeneID:10102171"
FT                   /translation="MSEAPARPLPQPTDLTRPYWQAAARGELHMQHCGACGRWQFYPRP
FT                   FCIHCEAEALQWRPVAGTGKVYTYTVNHRAPNPFMKARLPYVVAMIELDEGPRLMANVL
FT                   DARPGDMAIGRRVEVAFERVSDDMALPQFRLLAE"
FT                   /protein_id="YP_004124822.1"
     atgagcgaag cccctgcacg ccccctgccg cagcccaccg acctcacccg tccctactgg        60
     caggccgcag cacgtggcga gctgcacatg cagcactgcg gtgcctgcgg ccgctggcag       120
     ttctacccgc ggccgttctg catccattgc gaagccgagg ccttgcagtg gcggcccgtg       180
     gcgggaacgg gcaaggtcta cacctatacc gtgaaccacc gcgcgcccaa cccgttcatg       240
     aaggcgcgcc tgccctatgt ggtggcgatg atcgaactgg acgaaggccc gcgcctgatg       300
     gccaacgtgc tggatgcgcg gcccggcgac atggccatag gccggcgcgt cgaagtggcg       360
     ttcgaacgcg tttccgacga catggcgctg ccgcagttcc ggctgctggc cgaatag          417
//

If you have problems or comments...

PBIL Back to PBIL home page