(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE148

ALDEN1_2.PE148       Location/Qualifiers
FT   CDS_pept        complement(163301..164461)
FT                   /locus_tag="Alide_0149"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2148"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2148 acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:319760886"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102172"
FT                   /translation="MNPSLSKSVAIVGVAESDLGKVPGKSALELQAQAAMLALADAGLK
FT                   LSDVDGVFAHTDDRFSSLQVSEFLGLRPRFVDSTNVGGMSNLLHVQRAMAAIAAGMCEV
FT                   ALITYGSTQLSDGSRKGGAVAADVPHTPRGQFILPYGHLSPIGYYAMVAQLHMHRYGTT
FT                   PKDLAEVAVAARRWAQLNPKAYRREPTSIDEVMASPLVAEPLRQRDCCLVTDGGGAMVV
FT                   VSAGRARDLRQKPVYVLGAAETHAHHYTPFNTGDWLDTGVASTAEAALRMAGVTRADID
FT                   VVQIYDHFTIGVIQSLEELGFCKRGEGGAFVADGALAPGGRLPVNTSGGGLSYGHPGMF
FT                   GMFVAIEAVRQLRGECGERQLPKAELALCHAPGLVFSCNTTMILGV"
FT                   /protein_id="YP_004124823.1"
     atgaatccat cgctgtccaa atccgtggcc atcgtcggcg tggccgaatc cgacctgggc        60
     aaggtgcccg gcaagtcggc gctcgagctg caagcccagg cggccatgct ggctctggcc       120
     gacgcgggcc tgaagctgtc cgacgtggac ggcgtgttcg cccacacgga cgaccgcttc       180
     tccagcctgc aggtgtccga gttcctgggc ctgcggccgc gcttcgtcga ttcgaccaac       240
     gtggggggca tgtccaacct gctgcacgtg cagcgcgcca tggcagccat cgcggccggc       300
     atgtgcgagg tggcgctcat cacctatggc agcacgcagc tgtccgatgg ctcgcgcaag       360
     ggcggggccg tggcggccga cgtgccgcac acgccgcgcg gccagttcat cctgccctat       420
     ggccacctga gccccatcgg ctactacgcc atggtggccc agttgcacat gcaccgctat       480
     ggcaccacgc ccaaagacct ggccgaggtg gccgtggccg cgcggcgctg ggcgcagctc       540
     aaccccaagg cctaccggcg cgaacccacc agcatcgacg aggtgatggc ctcgcccctg       600
     gtggccgagc cgctgcgcca gcgcgactgc tgcctggtga cggacggcgg cggcgccatg       660
     gtcgtggtgt ctgccgggcg cgccagggac ctgcggcaaa aacccgtcta cgtgctgggc       720
     gcggccgaaa cccacgcgca ccactacacg cccttcaaca ccggcgactg gctggacacg       780
     ggagtggcct ccacggccga agccgccttg cgcatggccg gcgtcacgcg cgccgacatc       840
     gacgtggtgc agatctacga ccatttcacg atcggcgtca tccagtcgct cgaagagctg       900
     ggcttttgca agcgcggcga gggcggcgcc ttcgtggccg atggcgcgct ggcgccgggc       960
     gggcgcctgc ccgtcaacac ttcgggcggc gggctgtctt atggccaccc aggcatgttc      1020
     ggcatgttcg tggccatcga ggccgtgcgc cagctgcgcg gcgaatgcgg cgagcgccaa      1080
     ctgcccaagg cggaactggc gctgtgccac gcgcccggcc tggtcttttc ctgcaacacc      1140
     acgatgattc tgggagtctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page