(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE149

ALDEN1_2.PE149       Location/Qualifiers
FT   CDS_pept        complement(164484..165641)
FT                   /locus_tag="Alide_0150"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reh:H16_A2149 acyl-CoA dehydrogenase,
FT                   long-chain specific"
FT                   /db_xref="GI:319760887"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102173"
FT                   /translation="MPMTSVSETPRPMFGAEHALYRASVARFIANEITPHHAEWEREGR
FT                   VPRQLWRDAGAAGLLCPSIADAYGGGGGDYLYSAIVVEEIARALATGVTGFTTHSENVA
FT                   PYLLEFGSEAQKREFLPKMASGEVVGSLAMTEPGAGSDLKAIRTTAKAVDGGFEITGQK
FT                   TFITNGAHADRVIVFAKTSPEAGARGISLFWVDTKTPGFAVGRVLDKIGQLAQDTAELF
FT                   FDKVFVPRDALIGELNAGFGYAMSGLVRERLLIALRCAVALEVALDWTIDYVKQRQAFG
FT                   HALIDNQYIRFRLADIKTHAAATRAFVDSCLAQYLQGQLTADGAAMAKLWASEATRAID
FT                   DLMQFFGGNGYMREYPIARAYADVRPNRIYGGSSEIMREVIARGL"
FT                   /protein_id="YP_004124824.1"
     atgcccatga cttccgtttc cgaaacgccg cgccccatgt tcggcgccga gcacgcgctg        60
     taccgcgcca gcgtggcgcg cttcatcgcc aacgagatca cgccgcacca cgccgagtgg       120
     gaacgcgaag gccgggtgcc gcgccagctc tggcgcgacg cgggcgcggc cgggctgctg       180
     tgccccagca ttgccgacgc atacggcggc ggcgggggcg actacctcta cagcgccatc       240
     gtggtggaag aaatcgcgcg tgcgctggcc acgggcgtga cgggtttcac cacgcactcc       300
     gagaacgtgg ctccgtatct gctcgaattc ggctccgagg cgcagaagcg cgagttcctg       360
     cccaagatgg ccagcggcga agtcgtcggc tcgctggcca tgaccgagcc cggcgcgggc       420
     agcgacctga aagccatccg caccacggcc aaggccgtcg atggcggttt cgagatcacg       480
     ggccagaaga ccttcatcac caacggcgcg catgccgacc gggtgatcgt cttcgccaag       540
     accagcccgg aagcgggcgc gcgcggcatc agcctgttct gggtggacac gaagaccccc       600
     ggcttcgccg tgggccgcgt gctcgacaag atcggccagc tcgcgcagga cacggccgag       660
     ctgttcttcg acaaggtgtt cgtaccgcgc gacgccttga tcggcgagct gaacgctggc       720
     ttcggctacg ccatgagcgg gctggtccgc gagcgcctgc tgatcgcgct gcgctgcgcg       780
     gtggcgctcg aagtggcgct cgattggacg atcgactacg tgaagcagcg ccaggccttc       840
     ggccatgcgc tgatcgacaa ccagtacatc cgcttccgcc tggccgacat caagacgcat       900
     gccgccgcca cgcgcgcttt cgtggacagc tgcctggcgc aatacctgca aggccagctc       960
     acggccgacg gcgcggccat ggccaagctg tgggccagcg aggccacgcg cgccatcgat      1020
     gacctgatgc agttcttcgg cggcaatggc tacatgcgcg agtaccccat cgcccgcgcg      1080
     tatgcggacg tgcgtcccaa ccgcatctat ggcggctcgt cggaaatcat gcgcgaagtg      1140
     atcgcgcgcg gcctgtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page