(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE15

ALDEN1_2.PE15        Location/Qualifiers
FT   CDS_pept        17834..19219
FT                   /locus_tag="Alide_0015"
FT                   /gene_family="HOG000076615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /codon_start="1"
FT                   /product="homoserine dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: ajs:Ajs_4155 homoserine
FT                   dehydrogenase"
FT                   /db_xref="GI:319760753"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="GeneID:10102038"
FT                   /translation="MFLEPQPSLLPETRAHAPATPPALRVGMIGMGTVGAGVWRVLRRN
FT                   QALIAARAGRPIDIVAVAARTPARAAAVLEGAPGVRLLADPMRLATDPGVDVVLELAGG
FT                   SGAARGWVLAALAHGKHVVTANKALLAEHGEELATVAARHGRTLAYEAAVAGGVPVVKA
FT                   LREGLAANRIHALAGVLNGTSNYILTRMQAGGLDLAAALAEAQALGYAEADPALDVDGT
FT                   DAAHKLALLAANAFGMPVRLDAVHVEGLRGLRQGDVAAAAQLGYAVRLLAIARRGAEGV
FT                   ELRVHPALVPERHALARLSGAANGLLVQGDAAGEAFYGGAGAGGEPTASAVLADLVDLA
FT                   RLPAGAHARAGVPTLGVHSRAAEQPAPLPMAQVRTRHFLRLLPGAALNEAEALRLLARA
FT                   GLSVQRRAWGPAPEGGAAPTLLLLTAPAPDAVAAHAAARLHERTGAIVRRLRVEDFSSS
FT                   EYA"
FT                   /protein_id="YP_004124690.1"
     ATGTTCCTAG AACCCCAGCC CAGCCTCTTG CCCGAAACGC GCGCCCACGC GCCGGCCACT        60
     CCCCCTGCCC TGCGTGTGGG CATGATCGGC ATGGGCACCG TGGGCGCCGG CGTGTGGCGC       120
     GTGCTGCGGC GCAACCAGGC GCTGATCGCG GCGCGCGCGG GGCGGCCCAT CGACATCGTC       180
     GCCGTGGCCG CGCGCACCCC CGCCCGGGCG GCGGCCGTGC TGGAGGGCGC GCCGGGCGTG       240
     CGCCTGCTGG CCGACCCCAT GCGGCTGGCC ACCGATCCCG GCGTGGACGT GGTGCTGGAG       300
     CTGGCCGGCG GCAGCGGCGC CGCGCGCGGC TGGGTGCTGG CCGCGCTGGC CCACGGCAAG       360
     CACGTGGTGA CGGCCAACAA GGCCCTGCTG GCCGAGCATG GCGAGGAGCT GGCCACGGTG       420
     GCCGCGCGCC ATGGCCGCAC GCTGGCCTAC GAGGCGGCCG TGGCCGGCGG CGTGCCCGTC       480
     GTCAAGGCGC TACGCGAGGG CCTGGCGGCC AACCGTATCC ACGCGCTGGC GGGCGTGCTC       540
     AACGGCACCA GCAACTACAT CCTCACGCGC ATGCAGGCGG GCGGCCTGGA CCTGGCCGCC       600
     GCGCTGGCCG AGGCCCAGGC CCTGGGCTAC GCCGAGGCCG ACCCGGCCCT CGACGTGGAC       660
     GGCACCGACG CCGCCCACAA GCTCGCGCTG CTGGCCGCCA ACGCCTTCGG CATGCCCGTG       720
     CGGCTGGACG CGGTGCACGT GGAGGGCCTG CGCGGCCTGC GGCAGGGCGA CGTGGCGGCG       780
     GCCGCGCAGC TGGGCTATGC GGTCAGGCTG CTGGCCATCG CGCGCCGCGG CGCGGAAGGT       840
     GTTGAGCTGC GCGTGCATCC CGCCCTGGTG CCGGAGCGCC ACGCGCTGGC GCGGCTTTCC       900
     GGCGCGGCCA ACGGCCTGCT AGTGCAGGGC GATGCCGCCG GGGAAGCGTT CTACGGCGGC       960
     GCGGGCGCAG GCGGCGAACC CACGGCCTCG GCCGTGCTGG CCGACCTGGT GGACCTGGCG      1020
     CGGCTGCCCG CGGGCGCCCA CGCGCGCGCC GGCGTGCCCA CGCTGGGCGT GCACAGCCGC      1080
     GCGGCGGAGC AGCCCGCGCC GCTGCCCATG GCGCAGGTGC GCACGCGCCA TTTCCTGCGC      1140
     CTGCTGCCGG GCGCGGCGCT GAACGAGGCC GAGGCGCTGC GCCTGCTGGC GCGCGCGGGC      1200
     CTGTCCGTGC AGCGCCGCGC CTGGGGCCCG GCGCCGGAGG GCGGCGCGGC GCCCACGCTG      1260
     CTGCTGCTCA CCGCACCCGC CCCGGACGCC GTGGCCGCGC ACGCGGCCGC GCGGCTGCAC      1320
     GAGCGCACCG GCGCCATAGT GCGGCGGCTG CGGGTGGAGG ACTTCAGTTC TTCGGAATAT      1380
     GCATGA                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page