(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE150

ALDEN1_2.PE150       Location/Qualifiers
FT   CDS_pept        complement(165676..167217)
FT                   /locus_tag="Alide_0151"
FT                   /gene_family="HOG000229987" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_A2150 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="GI:319760888"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102174"
FT                   /translation="MSPLEQWARERPEGIAYRMVPSGHAVSWRELELRSRKLSAAMVQA
FT                   GLRAGDGIALMLENHLRYFEILWAAHRIGLYYTPISRHLKTEEMSHIVRDCDAKWLFCS
FT                   ARTAGELDAQVLRGLPVRRVMLDGQADGFDEYEALIAAYADDVALPETPEGMDFCYSSG
FT                   TTGLPKGIKRALADAGKHFASKSDPRTHWKDFDTRSVYLSTAPFYHTAPVRWNMAVMRA
FT                   GGHCVMMEKFDAELTLQAIDRFKVTHAQFVPTMFIRMLRLPDDVKAQYDPGSLRYAVHA
FT                   AAPCPATVKRAMIDWWGPILYEFYSGTELVGRTSLDSHEWLAHPGSVGRAEVGRIHIVD
FT                   EAGRELPPGENGVIYFSGGPRFEYHKDPAKTHSAYNDRGWATYGDIGHVDEEGYLYLTD
FT                   RLANTIVSGGVNIYPQEAENVLHEHPAVLDVAVVGVPDAEFGEAVKAVVQLQPPHQASP
FT                   ALAAELIAYCRERISTLKCPRSVDFVDTLPRAESGKLLKRLVKARYWDGGRGIAH"
FT                   /protein_id="YP_004124825.1"
     atgtcaccgc ttgagcaatg ggcgcgcgag cgccccgagg gcatcgccta ccgcatggtg        60
     ccctcgggcc atgcggtgag ctggcgcgaa ctggagctgc gctcgcgcaa gctgtccgcc       120
     gccatggtgc aggccggcct gcgcgcgggc gacggcatcg cgctgatgct ggagaaccac       180
     ctgcgctatt tcgagattct ctgggccgcg caccgcatcg ggctgtacta cacgcccatc       240
     agccgccacc tgaagaccga ggagatgagc cacatcgtgc gcgactgcga cgccaagtgg       300
     ctgttctgct cggcccggac cgcgggcgag ctggatgcgc aggtgttgcg cggcctgccc       360
     gtcaggcgcg tgatgctgga tgggcaggcc gatggcttcg atgaatatga ggcgctgatc       420
     gccgcatacg ccgacgacgt ggccttgccc gagacgcccg agggcatgga cttctgctac       480
     tcctcgggca ccacgggcct gcccaagggc atcaagcgcg cgctggccga tgccggcaag       540
     cacttcgcca gcaagagcga cccccgcacg cactggaagg acttcgacac ccgctccgtc       600
     tacctctcga ccgcaccctt ctatcacacg gcccccgtgc gctggaacat ggccgtgatg       660
     cgcgcaggcg gccactgcgt gatgatggaa aagttcgacg ccgagctgac attgcaggcg       720
     atcgaccggt tcaaggtcac gcatgcgcag ttcgtgccga cgatgttcat ccgcatgctg       780
     cgcctgcccg acgacgtgaa ggcgcaatac gacccgggca gcctgcgcta tgcggtccac       840
     gccgctgccc cgtgcccggc cacggtcaag cgcgccatga tcgactggtg gggccccatc       900
     ctgtacgagt tctacagcgg caccgagctg gtgggccgca cctcgctgga ttcgcacgaa       960
     tggctggcgc accccggctc cgtgggccgc gccgaagtcg gccggataca catcgtggac      1020
     gaggccgggc gcgagctgcc gccgggcgag aacggcgtca tctacttctc gggcggcccg      1080
     cgcttcgagt accacaagga tcccgcgaag acccattcag cctacaacga caggggctgg      1140
     gccacctatg gcgacatcgg ccacgtggac gaggaggggt atctctacct gaccgaccgc      1200
     ctggccaaca ccatcgtctc gggcggcgtg aacatctacc cgcaggaggc cgagaacgtg      1260
     ttgcacgagc acccggccgt gctcgacgtg gccgtggtcg gcgtgcccga tgccgagttc      1320
     ggcgaagccg tgaaggccgt ggtgcagctg cagccgccgc accaggcatc ccccgcgctg      1380
     gcggccgagc tcatcgcgta ctgccgcgag cgcatttcga ccctcaaatg cccgcgcagc      1440
     gtggatttcg tggacaccct gccgcgcgcc gaatcgggca agctgctcaa gcgcctggtg      1500
     aaggcacggt actgggacgg cggccggggc atcgcgcatt ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page