(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE151

ALDEN1_2.PE151       Location/Qualifiers
FT   CDS_pept        complement(167204..168139)
FT                   /locus_tag="Alide_0152"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.107"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.107"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2151 acyl dehydratase; PFAM: MaoC
FT                   domain protein dehydratase"
FT                   /db_xref="GI:319760889"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102175"
FT                   /translation="MAIDYDTLRQWQIADQRDRYGADDCIRYALSLGMGADPLDEADLR
FT                   YVLEGENMSVMPTWLACVGAPGAWASDPGTGIDWMQILHGEHRMRFHAPPPPEGEVLSQ
FT                   TRISRVVDKGAGKGALVVTERRASNAATGQLLATVEHVSFCRADGGFSSPAQPGDCAPQ
FT                   ALPAVPEREPDATMDMATLPGAALLYRLNGDRNPIHAQPGAARAAGFDRPILHGLCTFG
FT                   MAARALVRMACGNDPARLASIAARFSAPVFPGDTLQARLWFERDGDARQARFSVWARER
FT                   GRMVLSHGVADIRKPLASAGTARGQAHVTA"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-coahydratase"
FT                   /protein_id="YP_004124826.1"
     atggccatcg actacgacac cctgcgccag tggcagatcg ccgaccagcg cgaccgctac        60
     ggcgcggatg actgcatccg ctacgcattg agcctgggca tgggcgccga tccgctcgac       120
     gaagccgacc tgcgctatgt gctggaaggc gagaacatgt ccgtcatgcc cacgtggctg       180
     gcctgcgtgg gcgcgcccgg cgcctgggcg agcgaccccg gcacgggcat cgactggatg       240
     cagatcctgc acggcgagca ccgcatgcgc tttcatgcgc cgccgccgcc cgagggcgag       300
     gtactgagcc agacgcgtat cagccgcgtg gtggacaagg gggccggcaa gggcgccctc       360
     gtcgtgaccg agcgccgcgc cagcaacgcc gccacgggcc agctattggc cacggtggag       420
     cacgtgtcct tctgccgcgc cgacggcgga ttttcctcgc ccgcccagcc cggcgactgc       480
     gcgccgcagg ccctgccggc ggtgcccgag cgcgagccgg atgccacgat ggacatggct       540
     acgctgcccg gcgccgcgtt gctgtaccgc ctcaacggcg accgcaaccc catccacgcg       600
     cagcccggcg cggccagggc ggcggggttc gaccgtccca tcctgcacgg cctgtgcacc       660
     ttcggcatgg ccgcacgcgc cctggtgcgc atggcctgcg gcaacgaccc cgcacgcctg       720
     gccagcattg cggcgcgctt ttcggcgccc gtgttcccgg gcgacaccct gcaggcacgc       780
     ctgtggttcg agcgcgatgg cgatgcgcgc caggcacgtt tctcggtctg ggccagggag       840
     cgcggccgca tggtgctgag ccacggcgtg gccgacatcc gcaagcccct ggccagcgcc       900
     ggcaccgcac gaggacaagc ccatgtcacc gcttga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page