(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE152

ALDEN1_2.PE152       Location/Qualifiers
FT   CDS_pept        complement(168157..169080)
FT                   /locus_tag="Alide_0153"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   reh:H16_A2152 short chain dehydrogenase"
FT                   /db_xref="GI:319760890"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102176"
FT                   /translation="MNAQARPMDGKVVVVTGAGNGIGRATALLLAGQGASVVVNDLGAS
FT                   GSGEGSDAGPAQKVVDEITAAGGVAVANTDSVATPEGANAIIQTAITRFGRIDGVVNNA
FT                   GILRDRIFHKMNREEWQAVIDVHLNGSYYVSRAAAPYFKDQENGAYVHMTSTSGLVGNF
FT                   GQANYAAAKLGIAALSKSIALDMARFHVRSNCIAPFAWSRLIGTLPSETEAEKKRLERM
FT                   QSMKPEQVAQVAAFLLGNAARDISGQIFAVRGNEVMVMSQPRPVASVHSGEGWDAQSLA
FT                   DRAMPALRRAFTPLERSPEVFNWDPV"
FT                   /protein_id="YP_004124827.1"
     atgaatgcac aagcgcgtcc catggatggg aaggtggtcg tggtcacggg ggctggcaat        60
     ggcatcggcc gggccaccgc cctgctgctg gcgggccagg gcgccagcgt ggtggtcaac       120
     gacctggggg ccagcggcag cggcgagggc agcgatgccg ggcccgcgca aaaagtggtc       180
     gacgaaatca cggccgcggg cggcgtggca gtggccaaca ccgacagcgt ggccacgccc       240
     gagggagcca acgccatcat ccagacggcg atcacgcgct tcggccgtat cgacggcgtg       300
     gtgaacaacg ccggcatcct gcgcgaccgc atctttcaca agatgaaccg cgaggaatgg       360
     caggccgtga tcgacgtgca cctcaacggc agctattacg tcagccgcgc cgcggcgccg       420
     tatttcaagg accaggaaaa cggcgcctac gtgcacatga cgtccacctc gggcctggtc       480
     ggcaatttcg gccaggccaa ctacgccgcc gccaagctgg ggatcgccgc gctgtccaag       540
     tcgatcgcgc tggacatggc gcgctttcac gtgcgctcca actgcatcgc gcccttcgcg       600
     tggagccgcc tgatcggcac cctgcccagc gagaccgagg ccgagaagaa gcgcctggag       660
     cgcatgcagt cgatgaaacc cgaacaggtg gcgcaggtcg cggcgttcct gctcggcaac       720
     gcggcccggg acatcagcgg gcagatcttc gcggtgcgcg gcaacgaggt catggtcatg       780
     agtcagccgc gcccggtggc gtcggtgcac agcggcgagg gctgggacgc gcagtcgctg       840
     gccgaccgcg ccatgcccgc gctgcggcgc gcattcacgc cgctggagcg ctcgcccgag       900
     gtgttcaact gggaccccgt ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page