(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE153

ALDEN1_2.PE153       Location/Qualifiers
FT   CDS_pept        complement(169106..170089)
FT                   /locus_tag="Alide_0154"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2153"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2153 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760891"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102177"
FT                   /translation="MWSRIFQMGAPVIAAVSLALPLSAHSQGEVFKASKPMHIVAPSSP
FT                   GGILDQTSRLVAKALTDIVGQPVIVDNHPGAGGTIGIQTMLRAEPDGHTLVMGSLGPNA
FT                   ANYTLQDKLPYTAADMTGVIRVLTMPDVVVVNPKLPVKSIAELKAYAQNSPNGVSMAVS
FT                   TSGSSGHLAGAMLNQRAGIKAVEVVYRGASPALTDLVGGQVDYMVDNLITALPLVRSGK
FT                   LRAIAVTTRERSAELPDVPTLMELGYKDFDVSVWLGLFVSSKTPAATVQALNAALNKAL
FT                   SDPQVQKTIAQQGGSATGGSTEEFAQFVRNETTRWAEVIRAGNIKP"
FT                   /protein_id="YP_004124828.1"
     atgtggagca ggatttttca gatgggcgcg ccggtgattg cagccgtgtc gctggccctg        60
     ccgctgtccg cgcacagcca gggtgaggtt ttcaaggcct ccaagcccat gcacatcgtg       120
     gcgcccagtt cgcccggggg catcctggac cagaccagcc ggctggtggc caaggcgctc       180
     accgacatcg tcggccagcc ggtcatcgtc gacaaccacc caggcgccgg cggcaccatc       240
     ggcatccaga ccatgctgcg cgccgagccc gacgggcaca ccctggtgat gggcagcctg       300
     gggcccaatg ccgccaacta cacgctgcag gacaagctgc cctacacggc cgccgacatg       360
     accggggtga tccgcgtgct gaccatgccc gacgtggtcg tggtcaaccc caagctgccg       420
     gtgaagagca tcgcggagct caaggcctac gcgcagaaca gccccaacgg cgtatcgatg       480
     gcggtgtcca ccagcggttc gtccgggcac ctcgcgggcg cgatgctgaa ccagcgcgcg       540
     ggcatcaagg cggtcgaggt ggtgtaccgc ggcgcatcgc cggcactcac cgacctggtc       600
     ggagggcagg tggactacat ggtggacaac ctgatcaccg ccctgcccct ggtgcgctcg       660
     ggcaagctgc gcgccatcgc ggtgacgacg cgcgagcgca gcgcggagct gcccgacgtt       720
     cccacgctga tggagctggg ctacaaggat ttcgacgtgt cggtatggct gggcctgttc       780
     gtgtcgtcca agacgccggc ggccacggtg caggccttga acgccgcgct caacaaggcg       840
     ctgtccgacc cacaggtgca gaaaaccata gcgcagcaag gcggctcggc cacgggcggc       900
     agcaccgagg agttcgctca attcgtgcgc aatgaaacca cgcgctgggc cgaggtgatt       960
     cgcgccggca acatcaagcc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page