(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE154

ALDEN1_2.PE154       Location/Qualifiers
FT   CDS_pept        170319..171104
FT                   /locus_tag="Alide_0155"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2154 IclR family transcriptional
FT                   regulator; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760892"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102178"
FT                   /translation="MATPDSEGFVRSFARGLRVIEAMGRTGAHTVSSVAQDTELPRTVA
FT                   RRILLTLCELGYACPTPDKGFRLTPKVLSLGLTYLTSQPFWGHAQRVLETVCLQLRESC
FT                   AVAVMQGNEVVFVLRIPSAKVMSPHLGMGSRLPAYATAPGRVLLAYQGAGYQDQYFGQT
FT                   PLRPLTGQTQTDPAELRHELARIAQQGHAWVEGEYDAHVSGLSLPIYDERRKVVAALGA
FT                   SLLTSDFDRARAEREILPPLRAAAEQLSGLAPSFLAPVL"
FT                   /protein_id="YP_004124829.1"
     ATGGCCACTC CAGACAGCGA GGGTTTCGTC CGCTCATTCG CGCGCGGCCT GCGCGTGATC        60
     GAAGCGATGG GGCGCACCGG CGCGCACACG GTCAGCTCGG TCGCGCAGGA CACGGAGCTG       120
     CCGCGCACCG TGGCGCGGCG CATCCTGCTC ACGTTGTGCG AACTGGGCTA CGCCTGCCCG       180
     ACGCCGGACA AGGGCTTCCG GCTCACGCCC AAGGTGCTCA GCCTGGGCTT GACCTACCTG       240
     ACGTCGCAGC CCTTCTGGGG GCACGCGCAG CGCGTGCTGG AGACGGTGTG CCTGCAGTTG       300
     CGCGAGTCCT GCGCGGTCGC GGTCATGCAG GGCAACGAGG TGGTGTTCGT GCTGCGCATT       360
     CCATCGGCCA AGGTGATGTC GCCGCACCTG GGAATGGGCA GCCGCCTGCC GGCCTATGCC       420
     ACGGCGCCCG GCCGCGTCCT GCTCGCCTAC CAGGGGGCCG GTTACCAGGA CCAGTATTTC       480
     GGCCAGACCC CGTTGCGCCC GCTCACCGGA CAGACGCAGA CGGACCCTGC CGAATTGCGC       540
     CACGAGCTGG CGCGCATCGC CCAGCAAGGC CACGCCTGGG TCGAGGGGGA ATATGACGCG       600
     CATGTCAGCG GGCTGTCGCT GCCCATCTAC GATGAGCGCC GCAAGGTGGT GGCGGCCTTG       660
     GGCGCGAGTC TGCTGACGTC CGATTTCGAC CGCGCGCGCG CGGAGCGTGA GATATTGCCG       720
     CCTCTGCGGG CCGCGGCCGA ACAGCTGTCC GGCCTGGCGC CGAGCTTCCT GGCGCCGGTG       780
     CTGTGA                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page