(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE158

ALDEN1_2.PE158       Location/Qualifiers
FT   CDS_pept        complement(175711..177096)
FT                   /locus_tag="Alide_0160"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="mmge/prpd family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: dia:Dtpsy_0134
FT                   MmgE/PrpD family protein"
FT                   /db_xref="GI:319760896"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:10102183"
FT                   /translation="MKQEIQVSIHPLAQFAAQLQWSDVPAPVQDRAVDLWVDWFGSVLA
FT                   GCKARPVASIARFALSQGPASGPSEVIAQGASSSPMMAALANAAASHFAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQAIGASGAELMAACVAGYEVGIRVGEFLGRSHYKVFHTTATAGT
FT                   LAAAAAVGRLLQLTPAQMQHAFGSAGTQSAGLWEFLRTAADSKQLHTAHAAAAGLMAAY
FT                   LARDGFTGAQDIFTGAQGMAAGMSSDANPARLTDGLPNGGVGRWATAETSFKWHASCRH
FT                   THPAADALQQVMREHGLKPADIAQVTCHVHQGAIDVLGPVVSPTTVHQSKFSMGTVLAL
FT                   AAHFGHAGLTEFDAQFLAPDTVALREKVRMELDAEVDAAYPQRWIGKVTVQTTDGRRLH
FT                   GRVDEPKGDPGNTLSREEITAKALRLAAYGGAVGTAQATSAVASLWQVAQWPRVGDLLA
FT                   AGA"
FT                   /protein_id="YP_004124833.1"
     atgaagcaag aaatccaagt gagcatccac cccctggccc aattcgccgc ccagctgcag        60
     tggagcgacg tgcccgcgcc cgtgcaggac cgcgccgtcg acctgtgggt ggactggttc       120
     ggctccgtgc tcgccggctg caaggcgcgg ccggtggcca gcatcgcgcg cttcgcgctg       180
     tcgcagggcc cggccagcgg ccccagcgag gtcatcgcgc aaggcgcgag cagctcgccc       240
     atgatggccg cactggccaa cgccgcggcc agccacttcg ccgagcagga cgacgtgcac       300
     aacggctcgg tgttccaccc ggcggccgtg gtgttcccgc ccgcgctggc cgtggcgcag       360
     gccatcggcg ccagcggcgc cgagctcatg gcagcctgcg tggcgggcta cgaagtgggc       420
     atacgcgtgg gcgagttcct gggccgcagc cactacaagg tcttccacac cacggccacg       480
     gccggcacgc tggccgccgc tgccgccgtg gggcgcctgc tgcagctcac gcccgcgcag       540
     atgcagcacg ccttcggctc tgccggcacg cagtcggcgg ggctgtggga attcctgcgc       600
     accgccgccg acagcaagca gctgcacacg gcccacgccg cggcggccgg cctgatggcg       660
     gcctacctgg ccagggacgg cttcaccggc gcgcaggaca tcttcaccgg cgcgcagggc       720
     atggccgccg gcatgtccag cgacgccaat cccgcgaggc tgaccgacgg cctgccgaac       780
     ggcggcgtgg ggcgctgggc cacggccgag accagcttca agtggcatgc ctcgtgccgc       840
     cacacgcacc cggccgccga cgcgctgcag caggtcatgc gcgagcacgg cctcaagccc       900
     gccgacatcg cccaggtgac ctgccacgtg caccagggcg ccatcgacgt gctggggccg       960
     gtggtctcgc ccaccacggt gcaccagagc aagttctcca tgggcacggt gctggcattg      1020
     gccgcgcatt ttggccatgc gggtttgacc gaattcgacg cgcagttcct ggcgccggac      1080
     actgtcgcct tgcgcgagaa ggtgcgcatg gagctggacg ccgaggtcga cgccgcctac      1140
     ccgcagcgct ggatcggcaa ggtcaccgtg cagaccacgg acggccgccg gctgcatggc      1200
     cgcgtggacg agcccaaggg cgaccccggc aacaccctct cgcgcgagga gatcaccgcc      1260
     aaggcgctgc gcctggccgc ctatggcggc gccgtcggca cggcccaggc cacgagcgcc      1320
     gtcgcgtccc tgtggcaggt ggcgcagtgg ccgcgggtgg gtgatctgct ggccgccggc      1380
     gcgtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page