(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE16

ALDEN1_2.PE16        Location/Qualifiers
FT   CDS_pept        19379..21553
FT                   /locus_tag="Alide_0016"
FT                   /gene_family="HOG000242573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00491"
FT                   /codon_start="1"
FT                   /product="helicase c2"
FT                   /transl_table="11"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   ajs:Ajs_4158 ATP-dependent DNA helicase DinG"
FT                   /db_xref="GI:319760754"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="GeneID:10102039"
FT                   /translation="MSTQPWAGQALQSFEAVVQSTAGFRVREGQRRMAEQVAQTFAQAQ
FT                   LGKLEDEDSQPRRAIAVVQAGTGVGKSLAYSVPAIAMALARGTRVLISTATVALQEQLV
FT                   HKDLPALAARMEQPFQFALAKGRGRYVCKLKLERLAGGAAGGEDGVPDDDLFPEEAAAQ
FT                   RQRPRHDAEARMRFYASMADALATGGWDGDRDTLDSPPEPEAWSPVAAEASSCTGKHCP
FT                   LFSQCTYYERRKALVAAQVIVANHDLLLSSLGARLLPELDNCLLVIDEAHHLPATALQQ
FT                   FACEADLSRLTWIDKLASRALRIGQLVEVEEIADIPNHAARLRAALQDAARLVMDLYGE
FT                   QLRAPLPGRRQFSASMPTRARVQGGVLPEALAEPFSQAAHHAGGFLDALRAIAKALRGE
FT                   MRDKPDEARRLSQLYAQIGALAPRLEGVHAAAQLLLQDAPDGAVPAAKWFTLETDGDFI
FT                   VVRAHASPVLPGSTLQNHLWSAVRGAVLTSATLTGCGQFDFFLREAGLWGDDAVTTLAV
FT                   PSPFDYALQGTLVATETRAEPRDAQAFTAEMVDALLSDLALVEAGALVLFTSREQMRQA
FT                   VDLLPTAMRGAVLVQNTLPRPQLLARHRERVADGLPSIIFGMQSFGEGLDLPGRLCESL
FT                   FITKLPFAPPDDPVGEARAEWLRGAGRDPFSELVVPATAIRLAQWVGRAIRTEEDRAHV
FT                   YCYDKRLVRTGYGQRLLAGLPPFALQRRAA"
FT                   /protein_id="YP_004124691.1"
     ATGTCCACGC AGCCATGGGC CGGCCAGGCC CTGCAATCGT TCGAGGCGGT AGTGCAGTCC        60
     ACCGCCGGCT TTCGCGTGCG CGAGGGCCAG CGGCGCATGG CCGAGCAGGT GGCGCAGACC       120
     TTCGCCCAGG CGCAGCTGGG CAAGCTGGAG GACGAGGACT CCCAGCCCCG GCGCGCCATC       180
     GCCGTGGTGC AGGCCGGCAC GGGCGTGGGC AAGTCGCTGG CCTACAGCGT GCCGGCCATC       240
     GCCATGGCGC TGGCGCGCGG CACGCGCGTG CTGATCTCCA CGGCCACGGT GGCGCTGCAG       300
     GAGCAGCTGG TGCACAAGGA CCTGCCGGCG CTCGCCGCGC GCATGGAGCA GCCCTTCCAG       360
     TTCGCGCTGG CCAAGGGGCG CGGGCGCTAC GTGTGCAAGC TCAAGCTGGA GCGCCTGGCC       420
     GGCGGCGCCG CGGGCGGCGA GGATGGGGTG CCCGACGACG ACCTGTTCCC CGAAGAGGCC       480
     GCGGCGCAGC GACAGCGGCC GCGCCACGAC GCCGAGGCGC GCATGCGCTT CTACGCCAGC       540
     ATGGCCGACG CGCTGGCCAC GGGCGGCTGG GACGGCGACC GCGACACCCT GGACAGCCCG       600
     CCCGAGCCCG AGGCCTGGAG CCCGGTGGCG GCCGAGGCGA GCTCGTGCAC CGGCAAGCAT       660
     TGCCCGCTGT TCAGCCAGTG CACCTACTAC GAGCGGCGCA AGGCCCTGGT GGCGGCGCAG       720
     GTCATCGTGG CCAACCACGA CCTGCTGCTG TCGTCGCTGG GCGCGCGGCT GCTGCCCGAG       780
     CTCGACAACT GCCTGCTCGT GATCGATGAG GCGCACCACC TGCCCGCCAC GGCGCTGCAG       840
     CAATTCGCCT GCGAGGCCGA CCTCTCGCGC CTGACCTGGA TCGACAAGCT CGCCAGTCGC       900
     GCGCTGCGCA TAGGCCAGCT GGTGGAGGTG GAGGAGATCG CCGACATCCC CAACCATGCC       960
     GCGCGCCTGC GCGCCGCGCT GCAGGACGCG GCGCGGCTGG TCATGGACCT GTACGGCGAA      1020
     CAGCTGCGCG CTCCCTTGCC GGGCCGCCGG CAGTTCAGCG CCTCCATGCC CACGCGAGCC      1080
     CGCGTGCAGG GCGGCGTGCT GCCCGAGGCG CTCGCCGAGC CCTTCTCCCA GGCCGCGCAC      1140
     CATGCCGGGG GCTTTCTGGA TGCCCTGCGC GCCATTGCCA AGGCGCTGCG CGGCGAGATG      1200
     CGCGACAAGC CAGACGAGGC ACGGCGCCTG TCGCAGCTGT ATGCGCAGAT CGGCGCGCTG      1260
     GCACCGCGGC TGGAAGGCGT GCACGCCGCG GCCCAGCTGC TGCTGCAGGA CGCGCCCGAC      1320
     GGGGCGGTGC CCGCCGCGAA GTGGTTCACG CTGGAGACCG ACGGCGACTT CATCGTCGTG      1380
     CGCGCGCACG CCAGCCCCGT GCTGCCCGGG TCCACGCTGC AGAACCACCT GTGGTCGGCC      1440
     GTGCGCGGGG CGGTGCTCAC ATCGGCCACG CTCACGGGCT GCGGGCAGTT CGACTTCTTC      1500
     CTGCGCGAAG CCGGCCTGTG GGGCGACGAT GCCGTGACCA CGCTGGCCGT GCCCAGCCCC      1560
     TTCGACTACG CGCTGCAGGG CACGCTGGTG GCCACCGAGA CCCGGGCCGA GCCGCGCGAC      1620
     GCCCAGGCCT TCACGGCCGA GATGGTGGAC GCCCTGCTGT CCGACCTGGC CCTGGTCGAG      1680
     GCCGGCGCGC TGGTGCTGTT CACCTCGCGC GAGCAGATGC GCCAGGCCGT GGACCTGCTG      1740
     CCCACCGCCA TGCGCGGCGC CGTGCTGGTG CAGAACACCC TGCCCCGCCC GCAGCTGCTG      1800
     GCGCGCCACC GCGAGCGCGT GGCCGACGGC CTGCCCTCCA TCATCTTCGG CATGCAGTCC      1860
     TTCGGCGAGG GGCTGGACCT GCCCGGGCGC CTGTGCGAGT CGCTCTTCAT CACCAAGCTG      1920
     CCCTTCGCCC CGCCCGACGA CCCCGTGGGC GAGGCGCGCG CCGAATGGCT GCGCGGCGCG      1980
     GGGCGCGACC CGTTCAGCGA GCTCGTAGTG CCCGCCACCG CTATACGCCT AGCGCAATGG      2040
     GTGGGCCGCG CGATACGTAC CGAGGAAGAC CGCGCCCACG TGTACTGCTA CGACAAGCGC      2100
     CTGGTGCGCA CGGGCTACGG CCAGCGCCTG CTGGCAGGCC TGCCGCCGTT CGCGCTGCAG      2160
     CGGCGCGCGG CATAG                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page