(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE160

ALDEN1_2.PE160       Location/Qualifiers
FT   CDS_pept        complement(178339..179505)
FT                   /locus_tag="Alide_0162"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: dac:Daci_0198 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760898"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102185"
FT                   /translation="MIEQTSSNNHHEIRDAIRALCAEFPDEYFRKVDEQRAYPAEFVDA
FT                   LTKAGWMAALIPQEYGGSGLGLTEASVIMEEINRCGGNSGACHGQMYNMGTLLRHGSQA
FT                   QKEKYLPKIASGEWRLQSMGVTEPTTGTDTTKIKTSAVKKDGRYVVNGQKVWISRVQHS
FT                   DWMILLARTTPLAEVTKKSEGMSIFMVDLAEAQKKGLTVRPIPNMVNHETNELFFEDLE
FT                   IPEENLIGEEGKGFKYILDGLNAERTLIAAECIGDGYWFLDRVTSYVKDRQVFGRPIGQ
FT                   NQGVQFPIADAFIEVEAANLMRWKACELFDRHEPMGAQANMAKYLAAKASWEAANACLQ
FT                   FHGGFGFACEYDVERKFRETRLYQVAPISTNLIYSFVAEHILKLPRSF"
FT                   /protein_id="YP_004124835.1"
     atgatcgaac agaccagctc caacaaccac cacgagatcc gcgacgccat ccgcgccctg        60
     tgcgccgagt tccccgacga atacttccgc aaggtggacg agcagcgcgc ctacccggcc       120
     gagttcgtcg atgcgctgac gaaggccggc tggatggcgg cgctgatccc gcaggagtac       180
     ggcggctcgg gcctgggcct gaccgaggcc agcgtgatca tggaggagat caaccgctgc       240
     ggcggcaact ccggcgcctg ccacggccag atgtacaaca tgggcacgct gctgcgccac       300
     ggcagccagg cgcagaagga gaaatacctg cccaagatcg ccagcggcga atggcgcctg       360
     cagtccatgg gcgtgaccga gcccaccacc ggcaccgaca ccaccaagat caagaccagc       420
     gccgtgaaga aggacggccg ctacgtggtc aacggccaga aggtctggat tagccgcgtg       480
     cagcacagcg actggatgat cctgctggcg cgcaccacgc cgctggccga agtgacgaaa       540
     aagagcgagg gcatgtccat cttcatggtg gatctggccg aggcgcagaa gaagggcctg       600
     acggtgcgcc ccatccccaa catggtgaac cacgagacca acgagctgtt cttcgaggac       660
     ctggagatcc ccgaggagaa cctgatcggc gaggaaggca agggcttcaa gtacatcctg       720
     gacggcctga acgccgagcg cacgctgatc gccgccgagt gcatcggcga cggctactgg       780
     tttctggacc gcgtgaccag ctacgtgaag gaccgccagg tgttcggccg ccccatcggt       840
     cagaaccagg gcgtgcagtt ccccatcgcc gacgccttca tcgaggtcga ggccgcgaac       900
     ctcatgcgct ggaaggcctg cgagctgttc gatcggcacg agcccatggg cgcgcaggcc       960
     aacatggcca agtacctcgc ggccaaggcg agctgggagg ccgccaacgc ctgcctgcag      1020
     ttccacggcg gcttcggctt cgcctgcgaa tacgacgtgg agcgcaaatt ccgcgagacg      1080
     cggctgtacc aggtggcgcc gatctccacg aacctcatct actccttcgt ggccgagcac      1140
     atcctcaagc tgccgcgctc gttctga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page