(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE162

ALDEN1_2.PE162       Location/Qualifiers
FT   CDS_pept        180657..181574
FT                   /locus_tag="Alide_0164"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dia:Dtpsy_0138 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760900"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:10102187"
FT                   /translation="MAQKMVQDKVVVVTGAGGGIGRDMALALAAAGAKVVVNDIGTSTT
FT                   GEGQDAGPAQKVVEEIRAAGGQAVANMDSVAEAAAAGRIVQCALDHFGRIDGVVNNAGI
FT                   LRDRFFHKMSLDEWDAVVKVHLYGSYYMARAAANHFKEQESGAFVHMTSTSGLIGNFGQ
FT                   ANYSAAKLGLVALSKSIALDMQKFNVRSNCIAPFAWSRMIGSIPTDTPEQQARVAKIQQ
FT                   MTPNKIAPLAVYLLSDAAKDVNAQVFAVRNNEIFLMSQPRPVRSVHRSEGWTPEFIAEH
FT                   GMPALKSSFVPMERSGDVFSWDPV"
FT                   /protein_id="YP_004124837.1"
     ATGGCGCAGA AGATGGTGCA GGACAAGGTA GTGGTGGTCA CGGGTGCCGG CGGCGGCATA        60
     GGGCGCGACA TGGCGCTGGC CCTGGCGGCA GCGGGTGCCA AGGTGGTGGT CAACGACATC       120
     GGCACCTCCA CCACGGGCGA GGGCCAGGAC GCCGGCCCCG CGCAGAAGGT GGTCGAGGAG       180
     ATCCGCGCCG CAGGCGGCCA GGCCGTGGCC AACATGGACA GCGTGGCCGA GGCCGCAGCG       240
     GCCGGCCGCA TCGTGCAGTG CGCGCTGGAC CACTTCGGCC GCATCGACGG CGTGGTCAAC       300
     AACGCCGGCA TCCTGCGCGA CCGCTTCTTC CACAAGATGA GCCTGGACGA GTGGGACGCC       360
     GTGGTCAAGG TGCACCTGTA CGGCAGCTAC TACATGGCGC GCGCGGCCGC CAACCACTTC       420
     AAGGAGCAGG AGAGCGGCGC CTTCGTGCAC ATGACCTCCA CCTCGGGCCT GATCGGCAAC       480
     TTCGGCCAGG CCAACTACAG CGCGGCCAAG CTGGGGCTGG TGGCGCTGTC CAAGTCCATC       540
     GCGCTGGACA TGCAGAAGTT CAACGTGCGC TCCAACTGCA TCGCGCCGTT CGCCTGGAGC       600
     CGCATGATCG GCTCCATCCC CACCGACACG CCCGAGCAGC AGGCGCGCGT GGCCAAGATC       660
     CAGCAGATGA CGCCCAACAA GATCGCGCCG CTGGCCGTGT ACCTGCTGTC GGACGCCGCC       720
     AAGGACGTGA ACGCCCAGGT GTTCGCCGTG CGCAACAACG AGATCTTCCT CATGAGCCAG       780
     CCGCGCCCCG TGCGCTCGGT GCACCGCAGC GAGGGCTGGA CGCCCGAGTT CATCGCCGAG       840
     CACGGCATGC CGGCGCTCAA GAGCAGCTTC GTGCCCATGG AGCGCTCGGG CGACGTGTTC       900
     AGCTGGGACC CGGTGTAA                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page