(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE165

ALDEN1_2.PE165       Location/Qualifiers
FT   CDS_pept        183484..184767
FT                   /locus_tag="Alide_0167"
FT                   /gene_family="HOG000223272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02550"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ajs:Ajs_0123 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="GI:319760903"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="GeneID:10102190"
FT                   /translation="MSALADRLRQLIRPGDTLWWGQTTAEPLTLTRAVTAHRHALAQGA
FT                   RLRVFVGIAASDTLAPEQADAIDFFGYAAGGAHRRLADAGVLDILPCHYSHLPGLIRAG
FT                   VLPVDVVLLQVSPPDEQGRYSLGLAQEYLPAALEKARVVIAEVNPGIPWTHGGVHLRTG
FT                   DFALCIDAEHPPLEQSRSAPGPAEQAIARHIAALVEDGATLQLGVGNLPEAVLAALHGH
FT                   RDLGLHSGAVGDGIARLAEAGVLTNAKKSVDAGVGVGGILMGSECLRRWAHRNQQLALR
FT                   GTEYTHDPEVLAASHKLAAINAAIEVDLTGQINAEVAAGCYVGAVGGAVDFLRGAARSK
FT                   GGLPIVALPATAKGASRIVARLSGPVSTPRSDAGLIVTEHGVADLRGQPLSRRVRRLID
FT                   IAAPEHREDLERQAYETLRRCGAAFNQK"
FT                   /protein_id="YP_004124840.1"
     ATGAGCGCAT TAGCCGATCG GCTGCGGCAG CTCATCCGCC CCGGCGACAC GCTCTGGTGG        60
     GGCCAGACCA CGGCCGAGCC GCTCACGCTC ACGCGCGCCG TGACCGCGCA CCGCCATGCG       120
     CTGGCCCAGG GCGCAAGGCT GCGCGTGTTC GTGGGCATCG CCGCGTCGGA CACGCTCGCG       180
     CCCGAGCAGG CCGACGCGAT CGACTTCTTC GGCTACGCCG CGGGCGGCGC GCACCGCAGG       240
     CTGGCCGACG CGGGCGTGCT CGACATCCTG CCCTGCCACT ACTCGCACCT GCCGGGCCTG       300
     ATCCGCGCGG GCGTGCTGCC TGTCGACGTG GTGCTGCTGC AGGTCTCGCC GCCCGACGAG       360
     CAAGGCCGCT ACAGCCTGGG GCTGGCGCAG GAATACCTGC CCGCGGCGCT GGAGAAGGCG       420
     CGCGTGGTGA TCGCCGAGGT CAACCCCGGC ATCCCCTGGA CGCACGGCGG CGTGCACCTG       480
     CGGACCGGCG ACTTCGCACT GTGCATCGAC GCCGAGCACC CGCCGCTGGA GCAAAGCCGC       540
     AGCGCGCCCG GCCCGGCGGA GCAGGCCATC GCGCGCCACA TCGCCGCGCT GGTCGAGGAC       600
     GGCGCCACGC TGCAGCTGGG CGTGGGCAAC CTGCCCGAGG CCGTGCTCGC CGCGCTGCAC       660
     GGCCACCGCG ACCTGGGCCT GCACAGCGGC GCGGTGGGCG ACGGCATCGC CCGGCTCGCC       720
     GAGGCCGGCG TGCTGACCAA CGCGAAGAAG AGCGTGGACG CCGGCGTGGG CGTGGGCGGC       780
     ATCCTCATGG GCAGCGAATG CCTGCGCCGC TGGGCGCACC GCAACCAGCA GCTCGCCCTG       840
     CGCGGCACCG AGTACACGCA CGACCCCGAG GTGCTGGCCG CCAGCCACAA GCTGGCCGCC       900
     ATCAACGCCG CCATCGAGGT GGACCTCACG GGCCAGATCA ACGCCGAAGT GGCCGCGGGC       960
     TGCTACGTGG GCGCCGTGGG CGGCGCGGTG GACTTCCTGC GCGGCGCGGC GCGCAGCAAG      1020
     GGCGGCCTGC CCATCGTGGC GCTGCCGGCC ACGGCCAAGG GCGCCAGCCG CATCGTGGCC      1080
     CGGCTGTCTG GCCCCGTGAG CACGCCGCGC AGCGACGCGG GCCTGATCGT CACCGAGCAT      1140
     GGCGTGGCCG ACCTGCGCGG CCAGCCGCTG TCGCGCCGCG TGCGCCGGCT GATTGACATC      1200
     GCCGCGCCCG AACACCGCGA GGACCTGGAG CGCCAGGCCT ACGAGACGCT GCGCCGCTGT      1260
     GGCGCCGCGT TTAATCAAAA GTAA                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page