(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE166

ALDEN1_2.PE166       Location/Qualifiers
FT   CDS_pept        184834..186042
FT                   /locus_tag="Alide_0168"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   ajs:Ajs_0124 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="GI:319760904"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="GeneID:10102191"
FT                   /translation="MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVQKSGIDP
FT                   ARIDDVVMAQSYANSEVPCVGRWAALQAGLPVEVPGMQLDRRCGGGLQAIVTASMMVQS
FT                   GAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMI
FT                   ETAENLARDYSITRDEADAYALRSHQRAAAAWAAGRFADEVVPVQVPQRKGDPVTFARD
FT                   EGFRADVTTESLAKLRVLMPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLV
FT                   GWAAAGCEPSHMGIGPVPAVKKLLARLSLKIDDMDLVELNEAFACQVLAVLKGWGWQDQ
FT                   GAIEHKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVF
FT                   ERV"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_004124841.1"
     ATGCGCAGAG CCGCCATCGT CACCCCCGTC CGCACCCCCG TCGGCACCTT CGGAGGCAGC        60
     CTGCGGCCCG TGCCCGTCGA GGAGCTGGCC GCCACCACCG TGCGCGCCGT GGTCCAGAAG       120
     AGCGGCATAG ACCCCGCACG CATCGACGAC GTGGTCATGG CCCAGTCGTA CGCCAACAGC       180
     GAGGTGCCCT GCGTGGGCCG CTGGGCCGCG CTGCAGGCCG GCCTGCCCGT GGAGGTGCCG       240
     GGCATGCAGC TCGACCGGCG CTGCGGCGGC GGCCTGCAGG CCATCGTCAC GGCCTCGATG       300
     ATGGTGCAGA GCGGCGCCGC CGACGTCGTG ATCGCCGGCG GCGTGGAGAG CATGAGCAAC       360
     ATCGAGTACT ACAGCACCGA CATGCGCTGG GGGGCGCGCT CGGGCAACGT GCGCTTCTAC       420
     GACCGGCTGG ACCGCGGGCG CGAGCGCTCG CAGCCCGTGG AGCGCTTCGG CAAGATCTCC       480
     GGGATGATCG AGACCGCCGA GAACCTGGCG CGCGACTACT CCATCACGCG CGATGAGGCC       540
     GACGCCTACG CCCTGCGCAG CCACCAGCGC GCGGCGGCGG CCTGGGCCGC GGGGCGTTTC       600
     GCCGACGAGG TCGTCCCCGT GCAGGTGCCC CAGCGCAAGG GCGATCCGGT CACGTTCGCC       660
     AGGGACGAAG GCTTCCGCGC CGACGTGACG ACCGAGAGCC TGGCCAAGCT GCGCGTGCTC       720
     ATGCCGAACG GCACCGTGAC GGCCGGCAAC GCCAGCCAGC AGAACGATGC CAGCGCCGCC       780
     TGCCTGATCG TGGCCGAGGA CAAGCTGGCC GAGCTGGGCC TGACACCCAT GGCCACGCTG       840
     GTCGGCTGGG CCGCGGCGGG CTGTGAGCCC TCGCACATGG GCATAGGCCC GGTGCCGGCC       900
     GTCAAGAAGC TGCTGGCGCG CCTGAGCCTG AAGATCGACG ACATGGACCT CGTGGAGCTC       960
     AACGAAGCCT TCGCCTGCCA GGTGCTGGCC GTGCTCAAGG GCTGGGGCTG GCAGGACCAG      1020
     GGCGCCATCG AGCACAAGCT CAACGTGAAC GGCTCGGGCA TCTCGCTGGG CCACCCCATC      1080
     GGCGCCACCG GCGTGCGCAT CCTGGCCACG CTGCTGCACG AGCTGCAGCG CCGCAAGGGC      1140
     CGCTACGGCC TGGAGACCAT GTGCATCGGC GGCGGGCAGG GCATCGCGGC GGTGTTCGAG      1200
     CGCGTGTGA                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page