(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE167

ALDEN1_2.PE167       Location/Qualifiers
FT   CDS_pept        complement(186057..186980)
FT                   /locus_tag="Alide_0169"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_0188 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760905"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102192"
FT                   /translation="MDLNLVRMFIAIAESRNLTDAARRSGMTRSNVSRRLKALEREYGA
FT                   QLLRRTTRHVELTQAGRILYGHCQQAMNELQDAQRKIEQMHRTVSGEIRVRIPTGLGHF
FT                   YLKPLILEFCKNHPELQLRLVINDQIHDLVASKVDLAIHITSAPLVDHVATKVCDIRWC
FT                   LVCTPQYLQQHALHLEQPVDLKQARLIAPLALGQRVEFTGPGGAGKVLVQHGASIQSGD
FT                   YQFLFNAASQGLGIALLPSYAVCEALKRGDLVRVLQRYEVMGIGNALYVVRASNRQPSA
FT                   ATVAFIDLLTTSVRAMAPHWDLHDAP"
FT                   /protein_id="YP_004124842.1"
     atggatctga atctggtgcg catgttcatc gcgatcgcgg agtccaggaa tctcaccgac        60
     gccgcgaggc gatcgggcat gacgcgttcc aatgtctcgc gccgcctcaa ggcgctggag       120
     cgggaatacg gcgcgcagct gctgcgccgc acgacgagac atgtggagct gacgcaggcc       180
     gggcgcattc tttacgggca ctgccagcag gccatgaacg agctgcagga cgcgcagcgc       240
     aagatcgagc agatgcaccg caccgtcagc ggcgaaatac gggtgcgcat ccccaccggg       300
     ctggggcact tctatctcaa gcccctgatc ctggagttct gcaagaacca cccggagctc       360
     cagctgcgcc tggtcatcaa cgaccagatc cacgatctgg tggcgtccaa ggtcgatctg       420
     gcgatccaca tcacctcggc ccccctggtc gaccatgtcg cgaccaaggt gtgcgacatc       480
     cgctggtgcc tggtctgcac gccgcagtac ctgcaacagc atgcgctgca cctggagcag       540
     cccgtggacc tgaagcaggc ccggctgatc gcgcccctgg cgctgggaca gagggtggag       600
     ttcaccggcc cgggcggcgc gggcaaggtg ctggtgcagc acggcgcatc catccagtcg       660
     ggcgactacc agttcctgtt caacgcggcg tcgcagggcc tgggcatcgc cctgctgccc       720
     agctacgccg tgtgcgaagc gctcaagcgc ggcgacctgg tgcgcgtgct gcagcgctac       780
     gaggtcatgg gcatcggcaa tgcgctatac gtcgtgcggg catccaaccg ccagccatcg       840
     gcggccaccg tggcgttcat cgacctgctc accacgtccg tgcgcgcaat ggcgccgcac       900
     tgggacctgc acgatgcgcc atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page