(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE168

ALDEN1_2.PE168       Location/Qualifiers
FT   CDS_pept        187158..188342
FT                   /locus_tag="Alide_0170"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dac:Daci_0189 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760906"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102193"
FT                   /translation="MGTTPVQELMPLQGFTVLDLSQGVAGPYCAQLLAGQGARVIKVEP
FT                   PQGDWGRHVGVASDGHSTISSTYNSGKQSLAIDARRPEGRAVILRLAERADVIVQNFRP
FT                   QVVERLGLDYESLRARGLGPVYVSISGYGPDGPFADHPATDSVMQADSGLMHTNRDAGG
FT                   TPQRIGLLLADIAAGVYAAQACTAALLHKTRTAEGSHVQISLFNVCCALQSTVFSEELA
FT                   GAQAARQPVSAPNGIFDAADGKLTILALNNEQFLRICKAFDLRHWETDPRFASNALRLE
FT                   HKALLHAELSRKVAPQSLAQLEALLGQHQVLHARVREGRGVVEHPQARHLHTFQTIEQP
FT                   GFGPLLWAAAPWACHAGAAQPAPRIGEHSQAILHGLGLDAQEIAALVAQQVVAV"
FT                   /protein_id="YP_004124843.1"
     ATGGGTACGA CGCCGGTCCA GGAACTCATG CCGCTGCAGG GATTCACCGT GCTGGATCTG        60
     AGCCAGGGTG TGGCAGGCCC TTACTGTGCG CAGCTGCTGG CTGGCCAGGG CGCGAGGGTC       120
     ATCAAGGTCG AGCCGCCCCA GGGCGACTGG GGGCGCCACG TTGGCGTTGC CAGCGACGGA       180
     CACAGCACCA TTTCCAGCAC CTATAACAGC GGCAAGCAAA GCCTGGCCAT CGACGCCAGG       240
     CGCCCGGAAG GCAGGGCGGT GATCCTGCGG TTGGCGGAAC GGGCCGACGT CATCGTGCAG       300
     AACTTCCGCC CCCAGGTTGT GGAGCGCCTG GGCCTGGACT ACGAAAGCCT GCGGGCGCGC       360
     GGCCTCGGGC CCGTGTACGT GTCCATCAGC GGCTACGGGC CGGACGGGCC GTTCGCTGAC       420
     CATCCGGCCA CCGATTCCGT CATGCAGGCG GACTCGGGCC TGATGCACAC CAACCGGGAT       480
     GCCGGCGGAA CGCCGCAGCG CATAGGCCTG CTGCTGGCCG ATATAGCCGC CGGCGTGTAC       540
     GCGGCGCAGG CATGCACCGC GGCGCTGCTG CACAAGACCC GTACCGCGGA GGGCAGCCAC       600
     GTGCAGATCA GCCTGTTCAA CGTCTGCTGC GCGCTGCAGT CCACGGTCTT CTCCGAGGAG       660
     CTGGCCGGCG CGCAGGCCGC CCGGCAACCC GTCAGCGCGC CCAACGGGAT ATTCGACGCC       720
     GCGGACGGCA AGCTGACCAT ACTGGCCTTG AACAACGAGC AGTTCCTGAG GATCTGCAAG       780
     GCCTTCGACC TGCGGCACTG GGAAACCGAC CCGCGCTTTG CCAGCAACGC GCTGCGCCTG       840
     GAGCACAAGG CGCTGCTGCA TGCCGAGCTG TCCCGGAAGG TCGCGCCCCA ATCGCTGGCG       900
     CAGCTGGAGG CGCTGCTCGG GCAGCACCAG GTGCTGCACG CCCGTGTCCG GGAAGGCAGG       960
     GGCGTGGTGG AGCATCCGCA GGCCAGGCAT TTGCACACGT TCCAGACCAT TGAGCAGCCG      1020
     GGCTTCGGGC CGCTGCTGTG GGCCGCGGCG CCGTGGGCCT GCCATGCGGG CGCTGCGCAG      1080
     CCGGCGCCGC GCATAGGCGA GCACAGCCAG GCCATCCTGC ACGGCCTTGG CCTGGATGCG      1140
     CAGGAAATCG CTGCGCTCGT CGCGCAGCAG GTCGTCGCGG TTTGA                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page