(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE169

ALDEN1_2.PE169       Location/Qualifiers
FT   CDS_pept        188357..189382
FT                   /locus_tag="Alide_0171"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dac:Daci_0190 alcohol dehydrogenase"
FT                   /db_xref="GI:319760907"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:10102194"
FT                   /translation="MNTMKALVCREFGPPQDVVALQDVAPAPRAGMDEVLIEVHYATVS
FT                   HATGLLIEGRYQKTPPLPFVPGTEGVGRVLACGGDVGHVRPGDLVAFICDWGAYGEQIV
FT                   VHGATVYPIVAGLGALQALAVPISYGTAYAALHWRAQLRQGDTVLVLGAGSGVGAAAVE
FT                   LARLVEGVTVIACASSAQKRQAALQGGAHHAVGPDGLIGQVKQLTQGRGADLVFDPVGG
FT                   DLLLQALRCTAQNGKIVSIGFASGTIPQVPMNILLVKNLTVFGFFYGQYIGWTPANERV
FT                   KYAAQMQAMMAELFALARRGAIHPAVTQVFPMDQLCQALSALHGRNVVGKVALAIKGDI
FT                   P"
FT                   /protein_id="YP_004124844.1"
     ATGAACACCA TGAAAGCTCT CGTCTGCCGG GAATTCGGCC CGCCGCAGGA CGTGGTCGCG        60
     CTGCAGGATG TCGCACCGGC CCCCCGGGCC GGCATGGACG AAGTGCTGAT CGAAGTGCAC       120
     TACGCCACGG TGAGCCACGC CACCGGGCTG CTGATCGAGG GCCGCTATCA AAAGACCCCG       180
     CCGCTTCCCT TCGTGCCCGG CACGGAAGGC GTGGGCCGGG TGCTTGCCTG CGGCGGCGAC       240
     GTCGGCCACG TCAGGCCGGG GGACCTGGTG GCTTTCATCT GCGACTGGGG GGCTTACGGC       300
     GAGCAGATCG TGGTGCATGG CGCTACCGTG TACCCCATCG TCGCCGGGCT CGGTGCGCTG       360
     CAGGCGCTTG CCGTGCCGAT TTCCTACGGA ACGGCCTATG CGGCGCTGCA CTGGCGGGCG       420
     CAGCTGCGCC AGGGCGACAC CGTCCTGGTG CTGGGCGCGG GCTCGGGGGT TGGCGCCGCG       480
     GCGGTCGAGC TGGCGCGGCT TGTCGAAGGC GTCACGGTCA TCGCCTGCGC CAGCAGCGCG       540
     CAGAAGCGCC AGGCCGCGCT GCAGGGCGGC GCGCACCATG CGGTCGGGCC GGACGGCCTG       600
     ATCGGGCAGG TCAAGCAGCT CACGCAGGGG CGGGGCGCGG ACCTGGTGTT CGACCCCGTC       660
     GGCGGCGACC TGCTGCTGCA GGCGCTGCGC TGCACCGCGC AGAACGGAAA GATCGTCAGC       720
     ATAGGCTTTG CCAGTGGAAC GATTCCCCAG GTTCCCATGA ACATCCTGCT GGTCAAGAAC       780
     CTCACCGTGT TCGGCTTCTT CTATGGCCAA TACATAGGCT GGACACCGGC CAACGAGCGC       840
     GTGAAATACG CGGCGCAGAT GCAGGCCATG ATGGCCGAGC TCTTCGCGCT GGCCCGGCGC       900
     GGGGCCATCC ATCCGGCCGT CACCCAGGTT TTTCCCATGG ACCAACTCTG CCAGGCATTG       960
     AGTGCTTTGC ACGGCCGCAA CGTGGTGGGG AAAGTCGCAC TCGCAATCAA AGGAGACATA      1020
     CCATGA                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page