(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE17

ALDEN1_2.PE17        Location/Qualifiers
FT   CDS_pept        21566..22195
FT                   /locus_tag="Alide_0017"
FT                   /gene_family="HOG000258615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   KEGG: ajs:Ajs_4160 DNA polymerase III, epsilon subunit;
FT                   SMART: Exonuclease"
FT                   /db_xref="GI:319760755"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="GeneID:10102040"
FT                   /translation="MPSPIAVIDFETTGMTPAQGARATEVAIVLMEGERVVDRFASLMK
FT                   TGVWIPPFITRLTGITNAMVDAAPAAEPVMREAARFVGDAPMVAHNAAFDSRFWQSELR
FT                   HAGLDAPHPFACTVLLSRRIYPDAPSHSLGRLTDHLGLPRTGRAHRALADAEMAAALLA
FT                   RMQHELCRRFGLDWPDHALLMRLQRCARQSMGRMLLEQRQIANASG"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_004124692.1"
     ATGCCCTCCC CCATCGCCGT CATCGACTTC GAGACCACCG GCATGACCCC GGCCCAGGGC        60
     GCGCGCGCCA CCGAGGTGGC CATCGTGCTC ATGGAGGGCG AGCGCGTCGT GGACCGCTTT       120
     GCCAGCCTGA TGAAGACGGG CGTGTGGATA CCGCCCTTCA TCACCCGGCT CACGGGCATC       180
     ACCAACGCCA TGGTGGATGC CGCGCCCGCG GCCGAGCCGG TGATGCGCGA GGCCGCGCGC       240
     TTCGTGGGCG ACGCGCCCAT GGTGGCGCAC AACGCGGCAT TCGACAGCAG GTTCTGGCAG       300
     TCCGAGCTGC GGCATGCGGG CCTGGACGCG CCCCACCCGT TCGCCTGCAC GGTGCTGCTG       360
     TCGCGCCGCA TCTACCCGGA CGCGCCCAGC CACAGCCTGG GCCGGTTGAC CGACCACCTG       420
     GGCCTGCCGC GCACGGGCCG CGCCCACCGC GCGCTGGCCG ACGCCGAGAT GGCCGCAGCG       480
     CTGCTCGCGC GCATGCAGCA CGAGCTGTGT CGGCGCTTCG GCCTGGACTG GCCCGATCAC       540
     GCGCTGCTCA TGCGGCTGCA GCGCTGCGCG CGCCAGTCCA TGGGCCGGAT GCTGCTGGAG       600
     CAGCGCCAGA TCGCCAACGC AAGCGGCTGA                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page