(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE170

ALDEN1_2.PE170       Location/Qualifiers
FT   CDS_pept        189379..190404
FT                   /locus_tag="Alide_0172"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0191"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0191 hypothetical protein"
FT                   /db_xref="GI:319760908"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102195"
FT                   /translation="MKQHPHHATPAWHGSRRKALQALASAAALGAAALAPAVARAATDY
FT                   PKAPIRLVVPYPPGGPTDLVGRVVAVAMGDILKQSIFVDNKPGASGMVGSAMVAKAPAD
FT                   GYTLLSNASLHVINPAVYDKVPYDAFNDFAPITQIVDVPLVLVVRSDMPVSSVQELIAY
FT                   LKQSKGAVNFASAGNASSQHLSGELFKIRTGIAMQHVPYKGSSPALTDLMGGQVQLMFD
FT                   SMPSAMPFITSGKLKALAVTTRKRSSSLPQVPTMQEAGVAGFETSTWYGLWAPRNTPAD
FT                   VVGVLAKAAQEALRKPEVAAQYQRMGAEPVGSSPQEFEAYMKSEEKKWAEIVRLSGAKA
FT                   D"
FT                   /protein_id="YP_004124845.1"
     ATGAAGCAGC ACCCCCATCA CGCCACCCCC GCGTGGCATG GCAGCAGGCG CAAGGCGTTG        60
     CAGGCACTGG CGTCTGCGGC GGCACTCGGG GCGGCGGCCC TGGCGCCAGC GGTGGCACGG       120
     GCGGCGACGG ACTATCCCAA GGCGCCGATC AGGCTGGTCG TGCCCTATCC ACCGGGTGGC       180
     CCCACGGACC TGGTGGGGCG CGTGGTCGCG GTCGCGATGG GCGACATACT GAAGCAGAGC       240
     ATCTTCGTCG ACAACAAGCC CGGAGCCAGC GGCATGGTGG GCTCGGCAAT GGTGGCGAAA       300
     GCCCCGGCGG ACGGGTACAC GCTGCTGAGC AACGCCTCGC TGCACGTCAT CAACCCCGCC       360
     GTGTACGACA AGGTGCCGTA CGACGCGTTC AACGACTTCG CGCCCATCAC CCAGATCGTC       420
     GACGTGCCCC TGGTGCTGGT CGTCAGGAGC GACATGCCCG TATCCAGCGT GCAGGAGCTG       480
     ATCGCCTACC TGAAGCAGAG CAAGGGCGCG GTGAACTTCG CGTCGGCGGG CAACGCCTCG       540
     TCGCAGCACC TCTCGGGCGA GCTGTTCAAG ATACGGACGG GCATTGCGAT GCAGCACGTG       600
     CCCTACAAGG GAAGCTCGCC CGCGCTCACC GACCTGATGG GCGGGCAGGT GCAGCTGATG       660
     TTCGACTCCA TGCCTTCGGC CATGCCGTTC ATCACATCGG GAAAACTCAA GGCGCTTGCC       720
     GTCACGACCA GAAAACGCTC CAGCTCATTG CCACAGGTAC CGACCATGCA GGAGGCAGGG       780
     GTCGCCGGCT TCGAAACCAG CACCTGGTAC GGGCTGTGGG CGCCGAGGAA CACGCCTGCG       840
     GACGTGGTGG GGGTGCTGGC GAAGGCCGCG CAGGAGGCGC TCAGGAAACC CGAAGTCGCG       900
     GCGCAGTACC AGCGCATGGG GGCCGAGCCC GTGGGCTCCA GTCCTCAGGA GTTCGAGGCC       960
     TACATGAAAT CCGAAGAGAA GAAGTGGGCC GAGATCGTGC GGCTGTCCGG TGCCAAGGCC      1020
     GACTAG                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page