(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE171

ALDEN1_2.PE171       Location/Qualifiers
FT   CDS_pept        complement(190435..191343)
FT                   /locus_tag="Alide_0173"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aav:Aave_3679 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760909"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102196"
FT                   /translation="MKILSPSLIELHAFLAVCRQGSFRRAADDLCVTQAAVSRAVQRLE
FT                   EHLAAGRLFERSPAGVVLTPRGAQWRKLVERHVLALESAAETLGRASRPRLVRLSVIPT
FT                   LSIQWLMPRLPGFHERSPGVKVELRQFRHDEDFTRDDVDLWLDVKRPSRRWPERIQTRY
FT                   LIGRELIPVCTARLAKAYRTPRDLQGATLLHHTNFPDNWARWFAKAGAPCTPRLGPGFD
FT                   LTMHLIVAAKAEMGVAVVPACLVERELRAGELVMPFDVEVSSGRGYFLCWKRDAAAFAA
FT                   REEFSGWLLEQAHAGGGPGAG"
FT                   /protein_id="YP_004124846.1"
     atgaagatcc tctctccgtc actgatcgag ctgcacgcct tcctggccgt ctgccggcag        60
     ggcagctttc gccgcgcggc ggacgacctg tgcgtgaccc aggccgccgt gagccgcgcg       120
     gtgcagcgcc tggaagaaca cctggccgcc gggcggctgt tcgagcgctc ccccgccggg       180
     gtggtgctca cgccgcgcgg ggcgcagtgg cgcaagctcg tcgagcgcca tgtgctggcg       240
     ctggagtcgg cggcggaaac gctgggccgg gcgtcgcggc cccggctcgt gcgcctgagc       300
     gtcattccca ccctgagcat ccaatggctc atgccgcggc tgcccgggtt ccacgagcgc       360
     agccccggcg tgaaggtgga gctcaggcag ttccggcacg acgaggactt cacgcgcgac       420
     gacgtcgacc tgtggctgga cgtgaagcgc cccagccgcc gctggcccga gcgcatacag       480
     acccgctacc tgatcggccg cgaactcatc cccgtgtgca ccgcgcgcct ggccaaggcg       540
     taccgcacgc cgcgcgacct gcagggcgca accctgctgc accacacgaa tttccccgac       600
     aactgggcac gctggttcgc caaggccggc gcgccctgca cgccgcgcct ggggcccggg       660
     ttcgatctga cgatgcacct catcgtcgcc gccaaggccg agatgggcgt cgccgtggtc       720
     cccgcctgcc tggtggagcg cgaactgcgg gccggcgagc tggtcatgcc gttcgacgtc       780
     gaggtgtcat ccgggcgcgg ctacttccta tgctggaagc gcgacgccgc cgccttcgcg       840
     gcgcgggaag aattctctgg ctggctcctg gagcaggcac acgccggggg cggcccgggg       900
     gcagggtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page