(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE173

ALDEN1_2.PE173       Location/Qualifiers
FT   CDS_pept        192432..193631
FT                   /locus_tag="Alide_0175"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.32"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: aav:Aave_3677
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:319760911"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:10102198"
FT                   /translation="MSAAPDRRAAYARIDQLLPYEQELVAIRRHLHQNPELAFAEHGTA
FT                   DFVAGRLQEWGYEVARGIGGTGVVGTLRQGDGSRRLGIRADMDALPIQEATGAAHASRA
FT                   PGLMHACGHDGHMAMLLGAAKYLARQRNFSGTLHLIFQPAEERGFDSGGKAMVDDGLFE
FT                   RFPCDAVYAMHNHPGVPQGRFLLRSGAFMAAGDRVFIKVLGVGGHAARPHLAADPLVAA
FT                   AAIVTGLQTVVARNVDPAESAVVTVGRLRAGDALNVIPADAEIGISVRSFAPQVRALLK
FT                   ERITALATGIAQAHGTRAEIDYVEGYPVLVNDPEAVALAAQVATDLVGADAVDLEHPRL
FT                   MGSEDFAYMLQRCPGALVRIGNGPADGGRGLHNPKYDFNDCNLPYGAAFWSQLAQRFLC
FT                   "
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_004124848.1"
     ATGAGCGCCG CCCCGGACCG CCGGGCGGCG TATGCCCGGA TCGACCAGCT CCTGCCCTAC        60
     GAGCAGGAGC TGGTGGCCAT ACGCCGCCAC CTGCACCAGA ACCCGGAGCT TGCCTTTGCC       120
     GAGCACGGCA CGGCGGACTT CGTCGCGGGC CGGCTGCAGG AGTGGGGCTA CGAGGTAGCG       180
     CGCGGCATCG GCGGCACCGG CGTGGTGGGC ACCCTGCGCC AGGGGGACGG CAGCCGCCGC       240
     CTGGGCATCC GCGCCGACAT GGATGCGCTG CCCATCCAGG AGGCCACCGG CGCGGCGCAT       300
     GCCAGCCGCG CGCCGGGGCT GATGCACGCC TGCGGGCACG ACGGGCACAT GGCCATGCTG       360
     CTGGGCGCCG CCAAGTACCT GGCGCGCCAG CGCAACTTCA GCGGCACGCT GCACCTGATC       420
     TTCCAGCCCG CCGAGGAGCG CGGCTTCGAC AGCGGCGGCA AGGCGATGGT GGACGATGGG       480
     CTCTTCGAGC GCTTCCCCTG CGACGCGGTG TACGCCATGC ACAACCACCC GGGCGTGCCC       540
     CAGGGGCGCT TCCTCCTGCG CAGCGGCGCC TTCATGGCGG CGGGCGACCG CGTGTTCATC       600
     AAGGTCCTGG GGGTGGGCGG GCATGCGGCG CGGCCGCACC TGGCGGCAGA CCCGCTGGTG       660
     GCCGCCGCGG CCATCGTCAC GGGCCTGCAG ACGGTGGTCG CGCGCAACGT GGACCCGGCC       720
     GAGTCGGCCG TGGTCACGGT GGGGCGCCTG CGCGCCGGCG ACGCCTTGAA CGTGATACCC       780
     GCCGATGCCG AGATCGGCAT CAGCGTGCGC TCCTTCGCGC CGCAGGTGCG GGCCCTGCTC       840
     AAGGAGCGCA TCACGGCGCT CGCCACCGGC ATTGCGCAGG CGCACGGCAC GCGCGCGGAG       900
     ATCGACTACG TCGAGGGCTA CCCGGTGCTG GTGAACGACC CCGAGGCCGT GGCGCTCGCC       960
     GCGCAGGTGG CCACCGACCT GGTGGGCGCC GACGCCGTGG ACCTGGAACA CCCCCGGCTC      1020
     ATGGGCAGCG AAGACTTCGC CTACATGCTG CAGCGCTGCC CCGGCGCGCT CGTGCGCATC      1080
     GGCAATGGCC CGGCCGATGG CGGGCGCGGC CTGCACAACC CGAAGTACGA CTTCAACGAC      1140
     TGCAACCTGC CCTACGGCGC GGCCTTCTGG AGCCAGCTGG CGCAGCGGTT CCTGTGTTGA      1200
//

If you have problems or comments...

PBIL Back to PBIL home page