(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE176

ALDEN1_2.PE176       Location/Qualifiers
FT   CDS_pept        196319..197302
FT                   /locus_tag="Alide_0178"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0145"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0145 hypothetical protein"
FT                   /db_xref="GI:319760914"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102201"
FT                   /translation="MPIHMTRRSLVAGGLLAAAAQPFAALASDAWPTKPVRFIVPFPPG
FT                   GPVDTTARAASVKLSEIWKTPTVIDNRAGAGGVVGAQAAAREAPDGYTLFMGAIHHSVN
FT                   PTLMGNLPYDIERDFAPISFAAMFPVFIVAHQSVPANTLKELIALARKPGSNLSYGSSG
FT                   NGGGTHLAGELFNMEAGTKLQHVPYKGSAPAMNDLLGGQVQLMFSDAPTALPHIKSGRI
FT                   KVLAVASRQRSAMLPDVPTAAEAGLPGYEAYSWAALFAPAKTPQAVLDKINADFNTAFR
FT                   DPAVRQRLLDAGAEAAPGTQQEMRQFLRSELAKWAKVIKTAGITAG"
FT                   /protein_id="YP_004124851.1"
     ATGCCCATCC ACATGACACG CCGCAGCCTG GTCGCCGGCG GCCTGCTGGC CGCGGCCGCG        60
     CAGCCCTTCG CCGCCCTGGC CTCCGATGCT TGGCCCACCA AGCCGGTGCG CTTCATCGTG       120
     CCCTTTCCGC CCGGCGGCCC CGTTGACACC ACGGCGCGTG CCGCGAGCGT GAAGCTGTCC       180
     GAGATCTGGA AGACGCCCAC CGTGATCGAC AACCGCGCGG GCGCGGGCGG CGTGGTCGGC       240
     GCGCAGGCCG CGGCCCGCGA GGCGCCCGAT GGCTACACCC TGTTCATGGG CGCCATCCAC       300
     CACTCGGTCA ACCCCACGCT GATGGGCAAC CTGCCCTACG ACATCGAGCG CGACTTTGCG       360
     CCCATCAGCT TCGCCGCCAT GTTCCCCGTG TTCATCGTGG CGCACCAGTC GGTTCCGGCC       420
     AATACGCTCA AGGAGCTCAT CGCCCTGGCC AGGAAGCCGG GCAGCAACCT GAGCTACGGC       480
     TCGTCAGGCA ATGGCGGCGG CACGCACCTG GCGGGCGAGC TGTTCAACAT GGAGGCAGGC       540
     ACCAAGCTGC AGCACGTGCC CTACAAGGGC AGCGCGCCGG CCATGAACGA CCTGCTGGGC       600
     GGCCAGGTGC AGCTGATGTT CAGCGACGCG CCCACGGCGC TACCGCACAT CAAGAGCGGG       660
     CGCATCAAGG TGCTGGCCGT GGCCAGCCGC CAGCGCTCGG CCATGCTGCC CGACGTGCCC       720
     ACTGCGGCCG AGGCGGGGCT TCCCGGCTAC GAGGCCTATT CCTGGGCCGC GCTGTTCGCT       780
     CCCGCCAAGA CGCCCCAGGC CGTGCTGGAC AAGATCAATG CAGACTTCAA CACCGCCTTT       840
     AGGGACCCCG CCGTGCGCCA GCGCCTGCTG GACGCCGGCG CCGAGGCAGC GCCGGGCACG       900
     CAGCAGGAGA TGCGCCAGTT CCTGCGCTCC GAGCTGGCCA AGTGGGCCAA GGTGATCAAG       960
     ACCGCCGGGA TCACGGCGGG CTGA                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page