(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE179

ALDEN1_2.PE179       Location/Qualifiers
FT   CDS_pept        199825..200244
FT                   /locus_tag="Alide_0181"
FT                   /gene_family="HOG000229752" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   ajs:Ajs_0128 hypothetical protein"
FT                   /db_xref="GI:319760917"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="GeneID:10102204"
FT                   /translation="MLASDTTYQPLPMHLSAQTHYQAELDAGRFCIQRCPQCQNHVFTP
FT                   RELCPHCGAGGLRWVRASGLGTVYSTSTIARKQDAGGNYNVALIDLDEGVRMMSRVEGL
FT                   APEGVAIGLRVQAHVAQKDGRGLVLFQPAAQGGAA"
FT                   /protein_id="YP_004124854.1"
     ATGCTGGCAA GCGACACGAC TTATCAGCCG CTACCCATGC ACCTGAGCGC ACAAACCCAC        60
     TACCAGGCCG AGCTCGATGC CGGCCGCTTC TGCATACAGC GCTGCCCGCA GTGCCAGAAC       120
     CATGTCTTCA CCCCGCGCGA GCTGTGCCCG CATTGCGGCG CCGGCGGCCT GCGCTGGGTG       180
     CGCGCGAGCG GCCTGGGCAC GGTCTATTCC ACGAGCACGA TCGCGCGCAA GCAGGACGCC       240
     GGCGGCAACT ACAACGTGGC GCTGATCGAC CTGGACGAAG GCGTGCGCAT GATGAGCCGC       300
     GTCGAGGGCC TGGCGCCTGA AGGCGTGGCC ATAGGCTTGC GCGTGCAGGC CCATGTGGCG       360
     CAAAAGGACG GGCGCGGCCT GGTGCTGTTC CAGCCCGCAG CACAAGGAGG TGCCGCATGA       420
//

If you have problems or comments...

PBIL Back to PBIL home page