(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE180

ALDEN1_2.PE180       Location/Qualifiers
FT   CDS_pept        200241..201449
FT                   /locus_tag="Alide_0182"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0129"
FT                   /codon_start="1"
FT                   /product="thiolase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0129 thiolase"
FT                   /db_xref="GI:319760918"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102205"
FT                   /translation="MSRIPRSHLDAAAVNRPLRGRVAIAGAATYGCGEAPGMDDMTLLV
FT                   RAAQAAVADAGLSMQDIDGLATCSVNASMWPMPVIEHLGINPTYVDGTMIGGSSFIAHL
FT                   LPAIRALEAGQCKAVLVCYGSAQRSATFGRKESQAARRFLDPQPYEFPYEPVLPVTAYA
FT                   LAAARHMHEFGTTRTQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRD
FT                   CCLVTDGGGAIVLTRAERARDLPRPPVYVLGNATAIWNRQISCMPDLTTTSASQSGAQA
FT                   FAMAGLKAADMDMAQVYDAFTINTILFLEDLGFCAKGEGGAFVENGGIAPGGRLAVNTN
FT                   GGGLSCVHPGMYGIFALIEAVRQLRGEAGARQLKRHSTAVVHGNGGTLSSQSTAVLGTT
FT                   ETL"
FT                   /protein_id="YP_004124855.1"
     ATGAGCCGCA TTCCCCGATC CCACCTGGAC GCGGCGGCCG TGAACCGTCC GCTGCGCGGC        60
     CGCGTGGCCA TTGCCGGCGC CGCCACCTAT GGCTGCGGCG AAGCCCCGGG CATGGACGAC       120
     ATGACCCTGC TGGTGCGCGC CGCGCAGGCG GCCGTGGCCG ACGCGGGATT GAGCATGCAG       180
     GACATCGACG GCCTGGCCAC CTGCAGCGTC AACGCCAGCA TGTGGCCCAT GCCGGTGATC       240
     GAGCATCTGG GCATCAACCC GACCTACGTG GACGGCACCA TGATCGGCGG TTCGAGCTTC       300
     ATCGCCCACC TGCTGCCGGC GATTCGCGCG CTGGAGGCCG GCCAGTGCAA GGCCGTGCTG       360
     GTGTGCTACG GCAGCGCGCA GCGCTCAGCC ACCTTCGGGC GCAAGGAAAG CCAGGCCGCG       420
     CGGCGCTTCC TCGACCCGCA GCCCTACGAG TTCCCCTACG AGCCCGTGCT GCCCGTGACC       480
     GCCTACGCGC TGGCCGCGGC GCGCCACATG CACGAGTTCG GCACCACGCG CACGCAGCTG       540
     GCCGAGGTGG CCGTGGCCGC GCGCGCCTGG GCGCAGCAAA ATCCCGAGGC CTTCATGCGC       600
     GACCCGCTCA CCATCGAGGA CGTGCTCGCG GCCCGGCCGA TCGCCAGCCC GCTCACCGTG       660
     CGCGACTGTT GCCTGGTGAC CGACGGAGGT GGCGCCATCG TGCTCACGCG CGCCGAGCGT       720
     GCACGCGACT TGCCCAGGCC CCCGGTCTAC GTGCTGGGCA ATGCCACGGC GATCTGGAAC       780
     CGCCAGATCT CGTGCATGCC CGACCTGACG ACGACCAGCG CGTCGCAGTC GGGTGCCCAG       840
     GCATTCGCCA TGGCGGGCCT GAAGGCGGCC GACATGGACA TGGCCCAGGT CTACGACGCC       900
     TTCACCATCA ACACCATCCT GTTCCTGGAG GACCTGGGCT TCTGCGCCAA GGGCGAGGGC       960
     GGCGCCTTCG TGGAGAACGG CGGCATCGCC CCCGGCGGGC GCCTGGCCGT CAACACCAAC      1020
     GGCGGCGGCC TGTCCTGCGT GCATCCGGGC ATGTACGGCA TCTTCGCGCT CATCGAGGCC      1080
     GTGCGCCAGC TGCGTGGCGA GGCCGGTGCG CGCCAGCTCA AGCGCCACAG CACGGCTGTG      1140
     GTGCATGGCA ACGGCGGTAC GCTGTCGAGC CAATCCACCG CCGTGCTCGG CACGACAGAA      1200
     ACCCTCTGA                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page