(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE181

ALDEN1_2.PE181       Location/Qualifiers
FT   CDS_pept        201469..202626
FT                   /locus_tag="Alide_0183"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: dia:Dtpsy_0148 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="GI:319760919"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102206"
FT                   /translation="MIRDPEILEALLDSVRRFVRERLVPAENEVAETDEIPETIVQEMR
FT                   ELGLFGMTIPEKFGGLELTMEEECRVLLELCQTAPAFRSVIGTTVGIGSQGILMDGTPE
FT                   QQAQWLPKLATGEVIASFALTEPEAGSDAASLRTTAILQGDHYVVNGTKRFITNAPHAG
FT                   MFTLMARTNPQDKGAGGVSSFIVDAKSPGISFGKYDKKMGQRGAHTCDVIFDNVKVPAA
FT                   NLIGLKEGQGFKTAMKVLEKGRIHIAAVAVGVAKRILRDALAYALERKQFGQPICEFQL
FT                   VQAMLADSQAELYAAECMTIDAARRRDDGHNVSTEASCAKMFATEMCGRVADRAVQILG
FT                   GAGYMAEYGIERFYRDVRLFRLYEGTTQIQQIIIARNMVRAARAA"
FT                   /protein_id="YP_004124856.1"
     ATGATCCGCG ACCCAGAAAT TTTGGAAGCC CTGCTCGACA GCGTGCGCCG CTTCGTGCGC        60
     GAGCGCCTCG TGCCGGCCGA GAACGAGGTG GCCGAGACCG ACGAAATCCC CGAAACCATC       120
     GTGCAGGAGA TGCGCGAGCT GGGCCTGTTC GGCATGACCA TCCCCGAGAA GTTCGGCGGC       180
     CTGGAGCTGA CCATGGAGGA GGAATGCCGC GTGCTGCTGG AGCTGTGCCA GACCGCGCCC       240
     GCGTTCCGCT CGGTGATCGG CACCACGGTG GGCATAGGCT CGCAGGGCAT CCTGATGGAC       300
     GGCACGCCCG AGCAGCAGGC CCAGTGGCTT CCCAAGCTGG CCACGGGCGA GGTCATCGCC       360
     TCGTTCGCGC TCACCGAGCC CGAGGCGGGA TCGGACGCCG CCTCGCTGCG CACCACGGCC       420
     ATCCTGCAGG GCGACCACTA CGTGGTCAAC GGCACCAAGC GCTTCATCAC CAACGCACCG       480
     CACGCCGGCA TGTTCACGCT GATGGCGCGC ACCAACCCGC AGGACAAGGG CGCGGGCGGC       540
     GTGTCCTCCT TCATCGTGGA TGCGAAGAGC CCCGGCATCA GCTTCGGCAA GTACGACAAG       600
     AAGATGGGCC AGCGCGGCGC GCACACTTGC GACGTGATTT TCGACAACGT CAAGGTGCCG       660
     GCAGCCAACC TGATCGGCTT GAAGGAAGGC CAGGGCTTCA AGACCGCCAT GAAAGTGCTG       720
     GAGAAGGGCC GCATCCACAT CGCCGCCGTG GCCGTGGGCG TGGCCAAGCG CATCCTGCGC       780
     GACGCGCTCG CGTACGCGCT GGAGCGCAAG CAGTTCGGCC AGCCGATCTG CGAATTCCAG       840
     CTCGTGCAGG CCATGCTGGC CGACAGCCAG GCCGAGCTCT ACGCCGCCGA GTGCATGACC       900
     ATCGACGCCG CGCGCCGCCG CGACGATGGG CACAACGTCT CCACCGAGGC CTCGTGCGCC       960
     AAGATGTTCG CCACCGAGAT GTGCGGCCGC GTGGCCGACC GCGCGGTGCA GATCCTGGGC      1020
     GGCGCGGGCT ACATGGCCGA GTACGGCATC GAGCGCTTCT ACCGCGACGT GCGCCTGTTC      1080
     CGCCTGTACG AGGGCACGAC GCAGATCCAG CAGATCATCA TCGCGCGCAA CATGGTGCGC      1140
     GCGGCGCGCG CCGCATGA                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page