(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE182

ALDEN1_2.PE182       Location/Qualifiers
FT   CDS_pept        202623..203054
FT                   /locus_tag="Alide_0184"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dac:Daci_0175 thioesterase superfamily protein"
FT                   /db_xref="GI:319760920"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102207"
FT                   /translation="MSEAGLPPDRNAFMRLIGAAQVPAPPGKVHMRLPHMREELLNQLP
FT                   AAHGGVVMTLLDSVMARAAAELPTAPSRTAVTVEMSSRFHRPARGALLAEGWVVHASRS
FT                   LCSCAAQLLDADGRLVATASGTFKYWLGKTSAGHPPSGG"
FT                   /protein_id="YP_004124857.1"
     ATGAGCGAAG CAGGCCTGCC GCCCGACCGC AATGCCTTCA TGCGCTTGAT CGGCGCCGCC        60
     CAGGTGCCGG CCCCGCCCGG CAAGGTGCAC ATGCGCCTGC CGCACATGCG CGAGGAACTG       120
     CTCAACCAGC TGCCGGCCGC GCATGGCGGC GTGGTCATGA CCCTGCTGGA CTCGGTGATG       180
     GCGCGCGCCG CGGCCGAGCT GCCCACGGCG CCATCGCGGA CCGCGGTGAC GGTGGAGATG       240
     AGCAGCCGCT TCCACCGCCC CGCGCGCGGC GCGCTGCTGG CCGAGGGCTG GGTGGTGCAC       300
     GCGAGCCGCA GCCTGTGCAG CTGCGCCGCG CAGCTGCTCG ACGCGGACGG CCGCCTCGTG       360
     GCCACGGCCA GCGGCACCTT CAAGTACTGG CTGGGGAAGA CCTCGGCCGG CCATCCGCCA       420
     TCGGGCGGCT AA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page