(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE183

ALDEN1_2.PE183       Location/Qualifiers
FT   CDS_pept        complement(203051..203800)
FT                   /locus_tag="Alide_0185"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_2216 regulatory proteins, IclR; PFAM:
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760921"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102208"
FT                   /translation="MPPSHPVNGAQSVERACALLRRIAAGHAEGVPLRRLVDDTGLDRT
FT                   TAWRLVSSLAAQGLVHKDEATGLYHLGLEAAALGAACMDRSPLVRACLPAMKALARLSG
FT                   DNVFLVVRSGDHSHCLHLEEGEHRVRSFALNVGGTRLLGQGVGSIALLARLGDDALVAH
FT                   YRRHEAEYQADDVGLARLRRWAVQTRDCGHSYGSSGGVAGIGLGFRVGSCADAALSVIA
FT                   PRSRLPRSRGAELALAMRREMGAWRLL"
FT                   /protein_id="YP_004124858.1"
     atgccgcctt cacatccggt caacggcgcg caaagcgtcg agcgcgcgtg cgccttgctg        60
     cgccgcatcg cggccgggca cgccgagggc gtcccgctgc gcaggctggt ggacgacacg       120
     ggactggaca ggaccaccgc ctggcgcctc gtctccagcc tggcggccca ggggctggtg       180
     cacaaggacg aggccaccgg cctctaccac ctgggcctgg aggccgccgc gctgggtgcg       240
     gcctgcatgg accgctcgcc cctggtgcgg gcctgcctgc cggcgatgaa ggcgctggcg       300
     cggctgtcgg gcgacaacgt gttcctggtg gtgcgctcag gcgaccacag ccactgcctg       360
     cacttggagg aaggcgagca ccgcgtgcgc tcgttcgcgc tcaacgtggg cggcacgcgg       420
     ctgctggggc agggggtggg cagcatcgcg ctactggcgc gactgggcga cgacgcgctg       480
     gtggcgcact accggcgcca cgaggccgag taccaggcag acgacgtggg cctggcccgg       540
     ctgcggcgct gggccgtgca gacgcgggac tgcggccatt cgtacggcag ttcgggcggg       600
     gtggccggga tcgggctggg gttccgcgtg gggtcctgcg ccgacgcggc gctgagcgtg       660
     atcgcgccgc gttcgcggct gccgcgctcg cgcggcgcgg agctggcgct ggcgatgcgg       720
     cgggagatgg gggcgtggag gctgctttag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page