(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE184

ALDEN1_2.PE184       Location/Qualifiers
FT   CDS_pept        203931..204917
FT                   /locus_tag="Alide_0186"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10518"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Twin-arginine translocation pathway, signal
FT                   sequence, subgroup; KEGG: vei:Veis_2212 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760922"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="GeneID:10102209"
FT                   /translation="MTANIDRRHLVQGLAAATALTALGARAQATPFPSRPVTLVVPFPA
FT                   GGATDSLVRQIAELAGRELGQPVVVENKPGAAGVLGANHVVRAAPDGYTLSVLPEPVFR
FT                   LPHLQKTAFDPMNDFSYVIHLSGYALGIAVRNDAPWRDWAGVVAEAKKRPGQISYGTTG
FT                   INGTMHVTVEEMAQRAGVRLNHVPYKGESEIIAALMGGHIDLGVTAGGIAPMVDDGRAR
FT                   VLVLWTARRAPRWPGVPTLREIGIDMVANSPFGIAGPKGLPPAVVKTLHDAFRKALEAP
FT                   ATRATLERLNQESAYLDSEAYAAFARERYETSRQQVQRLGLKPNAQQ"
FT                   /protein_id="YP_004124859.1"
     ATGACCGCCA ACATCGACCG CCGACACCTG GTGCAAGGCC TCGCTGCCGC CACCGCATTG        60
     ACGGCATTGG GCGCGCGCGC CCAGGCCACC CCCTTCCCCA GCCGCCCCGT CACGCTGGTG       120
     GTGCCCTTCC CCGCGGGCGG CGCCACCGAC AGCCTGGTGC GCCAGATCGC CGAGCTGGCC       180
     GGCCGCGAGC TGGGCCAGCC GGTCGTGGTG GAGAACAAGC CCGGCGCGGC CGGAGTGCTG       240
     GGGGCCAACC ACGTGGTGCG CGCCGCGCCC GACGGCTACA CGCTGTCGGT GCTGCCCGAG       300
     CCGGTGTTCC GCCTGCCGCA CCTGCAGAAG ACCGCGTTCG ATCCGATGAA CGACTTCAGC       360
     TACGTGATCC ACCTCTCGGG CTACGCGCTG GGCATCGCCG TGCGCAACGA CGCGCCCTGG       420
     CGCGACTGGG CCGGCGTGGT GGCCGAGGCG AAGAAGCGCC CCGGCCAGAT CAGCTACGGC       480
     ACCACGGGCA TCAACGGCAC CATGCACGTC ACGGTGGAGG AGATGGCGCA GCGCGCCGGC       540
     GTCCGGCTCA ACCACGTGCC CTACAAGGGC GAGTCGGAAA TCATCGCCGC GCTCATGGGC       600
     GGGCACATCG ACCTCGGCGT CACGGCCGGC GGCATCGCGC CCATGGTGGA CGACGGCCGC       660
     GCGCGCGTGC TGGTGCTGTG GACGGCCCGG CGGGCGCCGC GCTGGCCGGG CGTTCCGACG       720
     CTGCGCGAGA TTGGGATCGA CATGGTGGCG AACTCGCCCT TCGGCATCGC CGGCCCCAAG       780
     GGGCTGCCGC CGGCCGTGGT CAAGACGCTG CACGACGCCT TCCGCAAGGC GCTGGAGGCG       840
     CCGGCCACGC GCGCCACGCT GGAGCGACTG AACCAGGAGA GCGCCTACCT CGACAGCGAG       900
     GCCTACGCCG CCTTCGCGCG CGAACGCTAC GAAACCTCCC GCCAGCAGGT GCAGCGCCTG       960
     GGGCTCAAGC CGAACGCGCA GCAATGA                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page