(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE185

ALDEN1_2.PE185       Location/Qualifiers
FT   CDS_pept        204914..205774
FT                   /locus_tag="Alide_0187"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vei:Veis_2211 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760923"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102210"
FT                   /translation="MNYRSIYRPGLFAGQVIAITGGGSGIGRCTAHELASLGASLALIG
FT                   RNADKLQAVAGEIGQPDRVSTHACDIRDEEAVRATVAAIVARHGRIDGLFNNAGGQFPA
FT                   PLRDISQKGWEAVVRNNLTGGFVMARECFTQWMEAHGGSVVNVIADMWNGMPGMGHSGA
FT                   ARAGMLNFTETAACEWAASGVRVNAVAPGWIASSGLDTYPDAFKARIQTLARKVPLQRL
FT                   GTEAEVSAAVVFLLSAAAAFVTGTTLRVDGGVPNAKHTWALPAHANSQPYDGFPLYQKP
FT                   GFLES"
FT                   /protein_id="YP_004124860.1"
     ATGAACTACC GCTCCATCTA CCGCCCCGGC CTGTTCGCGG GTCAGGTCAT CGCCATCACG        60
     GGCGGCGGCT CGGGCATCGG CCGCTGCACC GCGCACGAGC TGGCCAGCCT GGGCGCATCG       120
     CTCGCGCTGA TCGGCCGCAA CGCCGACAAG CTGCAGGCCG TGGCCGGCGA GATCGGCCAG       180
     CCCGACCGCG TGAGCACGCA CGCCTGCGAC ATCCGCGACG AGGAGGCCGT GCGCGCCACC       240
     GTGGCCGCCA TCGTGGCGCG CCATGGCCGC ATCGACGGCC TGTTCAACAA CGCCGGCGGC       300
     CAGTTCCCCG CGCCGCTGCG CGACATCAGC CAGAAGGGCT GGGAGGCCGT GGTGCGCAAC       360
     AACCTCACCG GTGGCTTCGT GATGGCGCGC GAGTGCTTCA CGCAGTGGAT GGAGGCGCAC       420
     GGTGGCTCAG TCGTCAACGT GATCGCCGAC ATGTGGAACG GCATGCCGGG CATGGGCCAC       480
     TCGGGCGCGG CGCGCGCGGG CATGCTCAAT TTCACCGAGA CGGCGGCCTG CGAGTGGGCG       540
     GCCAGCGGCG TGCGCGTGAA CGCCGTGGCG CCGGGCTGGA TCGCCTCCAG CGGCCTGGAC       600
     ACCTACCCCG ACGCCTTCAA GGCACGCATC CAGACGCTGG CGCGCAAGGT GCCGCTGCAG       660
     CGCCTGGGCA CCGAGGCCGA GGTCTCGGCG GCGGTGGTCT TTCTGCTCAG CGCGGCCGCC       720
     GCCTTTGTCA CCGGCACCAC GCTGCGCGTG GACGGCGGCG TGCCCAACGC CAAGCACACC       780
     TGGGCGCTGC CCGCGCACGC CAACTCCCAG CCCTACGACG GCTTTCCGCT CTACCAAAAA       840
     CCCGGCTTCC TGGAATCCTG A                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page