(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE187

ALDEN1_2.PE187       Location/Qualifiers
FT   CDS_pept        206972..208591
FT                   /locus_tag="Alide_0189"
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /codon_start="1"
FT                   /EC_number="6.4.1.4"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4463 propionyl-CoA carboxylase;
FT                   PFAM: carboxyl transferase"
FT                   /db_xref="GI:319760925"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="GeneID:10102212"
FT                   /translation="MIPFASHIHPASEDFQSQRAGMLGLVGQLRALEQRAADASARAAS
FT                   SFAKRGALLPRERVARLLDPGMPFLPLCNLAGYGMDDPDPERCIPGGSQIAGIGFVSGV
FT                   RCMVVATDSGIDAGALTEAGNQKLMRCQDIALENRLPFVHLVESAGSNLRKYRVDKFIR
FT                   GGGMFYNLARLSASGLPVVTVVHGSSTAGGAYMPGLSDYVVMVRGRAKAFLAGPPLLKA
FT                   ATGEVATDEELGGTAMHASVSGLAEYVAEDDAHAIALARDILATLDWNDGMPAPGPDAE
FT                   PPHLDPDELAGVMVLEHRKPVDMREVIARLVDGSRWMDFKPDYGAATVCGHGRIEGHAV
FT                   GFVSNNGPIDPAGATKAAQFIQLCNQSGTPLVFLQNTTGFIVGRTSEEAGMIKHGSKMI
FT                   QALANSRVPQITIHCGASFGAGNYGMCGRAFRPRFCFSWPNARTAVMGGEQAATTLEIV
FT                   ARQQAERKGAPVDEDRLAAQKAEIVANFSAQASAFYTSGHLLDDGVIDPRDTRAVLAFV
FT                   LATAREAEARQPRAVQFGVARF"
FT                   /product="methylcrotonoyl-CoA carboxylase"
FT                   /protein_id="YP_004124862.1"
     ATGATTCCCT TCGCCTCTCA CATCCACCCC GCATCCGAGG ACTTCCAGTC ACAGCGTGCG        60
     GGCATGCTGG GCCTGGTCGG CCAGCTGCGC GCGCTCGAGC AGCGCGCGGC CGACGCCTCG       120
     GCCCGCGCCG CCTCCAGCTT CGCCAAGCGC GGCGCGCTGC TGCCGCGCGA GCGCGTGGCC       180
     CGGCTGCTCG ACCCCGGCAT GCCCTTCCTG CCACTGTGCA ACCTGGCCGG CTACGGCATG       240
     GACGACCCCG ACCCCGAGCG CTGCATCCCC GGCGGCTCGC AGATCGCCGG CATCGGCTTC       300
     GTCTCGGGCG TGCGCTGCAT GGTCGTCGCC ACCGACTCGG GCATAGACGC CGGCGCGCTC       360
     ACCGAGGCCG GCAACCAGAA GCTCATGCGC TGCCAGGACA TCGCGCTGGA GAACCGCCTG       420
     CCCTTCGTGC ACCTGGTCGA ATCGGCCGGC TCCAACCTGC GCAAGTACCG GGTGGACAAG       480
     TTCATCCGCG GCGGCGGCAT GTTCTACAAC CTGGCGCGCC TGTCGGCGAG CGGCCTGCCG       540
     GTGGTGACGG TGGTGCACGG CTCCTCCACC GCCGGCGGCG CCTACATGCC GGGCCTGTCG       600
     GACTACGTGG TGATGGTGCG CGGCCGGGCC AAGGCCTTCC TGGCCGGCCC GCCGCTGCTC       660
     AAGGCCGCCA CGGGCGAAGT CGCCACCGAC GAGGAACTGG GCGGCACCGC CATGCACGCG       720
     AGCGTGAGCG GCCTGGCCGA GTACGTGGCC GAGGACGACG CGCACGCCAT CGCCCTGGCG       780
     CGCGACATCC TGGCCACCCT CGACTGGAAT GACGGCATGC CCGCGCCCGG TCCGGACGCC       840
     GAGCCGCCGC ACCTGGACCC GGACGAACTG GCCGGCGTGA TGGTGCTGGA GCACCGCAAG       900
     CCGGTGGACA TGCGCGAGGT GATCGCGCGC CTGGTGGACG GTTCGCGCTG GATGGACTTC       960
     AAGCCCGACT ACGGCGCCGC CACCGTATGC GGCCACGGCC GCATCGAGGG GCATGCGGTG      1020
     GGCTTCGTCA GCAACAACGG CCCCATCGAC CCGGCCGGCG CGACCAAGGC CGCGCAGTTC      1080
     ATCCAGCTGT GCAACCAGTC GGGCACGCCC CTGGTCTTTC TGCAGAACAC CACGGGCTTC      1140
     ATCGTGGGCC GCACATCGGA AGAGGCCGGG ATGATCAAGC ACGGCAGCAA GATGATCCAG      1200
     GCACTGGCCA ACTCGCGCGT GCCGCAGATC ACCATCCACT GCGGCGCCTC GTTCGGCGCG      1260
     GGCAACTACG GCATGTGCGG GCGCGCGTTC CGGCCGCGCT TCTGCTTCTC GTGGCCCAAC      1320
     GCGCGCACCG CCGTGATGGG CGGCGAGCAG GCCGCCACCA CGCTGGAGAT CGTGGCGCGC      1380
     CAGCAGGCCG AGCGCAAGGG CGCGCCGGTG GACGAGGACC GGCTGGCCGC GCAGAAGGCC      1440
     GAAATCGTCG CCAACTTTTC CGCCCAGGCG AGCGCCTTCT ACACCAGCGG CCACCTGCTG      1500
     GACGACGGCG TGATCGATCC GCGCGACACC CGCGCCGTGC TGGCCTTCGT GCTGGCCACC      1560
     GCGCGCGAGG CCGAGGCGCG CCAACCCCGC GCCGTGCAGT TCGGCGTGGC CCGTTTTTGA      1620
//

If you have problems or comments...

PBIL Back to PBIL home page