(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE188

ALDEN1_2.PE188       Location/Qualifiers
FT   CDS_pept        208602..209765
FT                   /locus_tag="Alide_0190"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reu:Reut_B4462 acyl-CoA dehydrogenase,
FT                   C-terminal:acyl-CoA dehydrogenase, central region:acyl-CoA
FT                   dehydrogenase, N-terminal"
FT                   /db_xref="GI:319760926"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102213"
FT                   /translation="MLYTPEHHELMASIRRFIAAEIDPFVDEWEANEIFPAPELFKKMG
FT                   RLGFLGITKPEAYGGMGLDFSYALAAAEAIGHARAQGVGMGIGVQSNMATPALAAFGSD
FT                   ELKREFLAPAIAGDVVVSIGVSEQGAGSDVSSLKTRARRDGDDYVISGSKMWITNGTQA
FT                   DWICLLCNTSDGPVHKNKSLIVVPLKENGKRAKGVEVQKIKKFGMWSSDTAQIFFDEVR
FT                   VPVRHRIGEEGMGFIYQMKQFQEERLDGAARRLASIDLINETADYLRQRIAFGRPLLDN
FT                   QFIQYKLAELKTELEALRSLTYRATLAYVNGEDVIELASMAKLKAGRLGREIADWCMQF
FT                   QGGMGYTWDNRVSRAYRDYRLGSIGGGADEVMMMVIARKMGLMDMGA"
FT                   /protein_id="YP_004124863.1"
     ATGCTTTACA CCCCCGAACA CCACGAGCTG ATGGCCAGCA TCCGCCGCTT CATCGCGGCG        60
     GAGATCGATC CCTTCGTCGA CGAATGGGAG GCCAACGAGA TCTTCCCCGC GCCCGAACTG       120
     TTCAAGAAGA TGGGGCGCCT GGGCTTTCTC GGCATCACCA AACCCGAGGC CTATGGCGGC       180
     ATGGGGCTGG ACTTCTCCTA CGCGCTGGCC GCGGCCGAGG CCATAGGCCA CGCGCGCGCC       240
     CAGGGCGTGG GCATGGGCAT CGGCGTGCAG TCCAACATGG CCACGCCCGC GCTCGCGGCC       300
     TTTGGCTCGG ACGAGCTCAA GCGCGAGTTC CTGGCGCCCG CGATCGCCGG CGACGTGGTG       360
     GTGAGCATCG GCGTTTCGGA GCAGGGCGCG GGCTCCGACG TGTCCTCGCT CAAGACCCGC       420
     GCGCGCCGCG ATGGCGACGA CTATGTCATC AGCGGCTCCA AGATGTGGAT CACCAACGGC       480
     ACGCAGGCCG ACTGGATCTG CCTGTTGTGC AACACCTCCG ACGGGCCGGT GCACAAGAAC       540
     AAGTCGCTCA TCGTCGTGCC GCTCAAGGAG AACGGCAAGC GCGCCAAGGG CGTCGAGGTG       600
     CAGAAGATCA AGAAGTTCGG CATGTGGTCG TCCGACACCG CGCAGATCTT CTTCGACGAG       660
     GTGCGCGTGC CCGTGCGCCA CCGCATCGGC GAGGAGGGCA TGGGCTTCAT CTACCAGATG       720
     AAGCAGTTCC AGGAGGAGCG CCTGGACGGC GCGGCGCGGC GCCTGGCGAG CATCGATCTC       780
     ATCAACGAGA CGGCTGACTA CCTGCGCCAG CGCATCGCCT TCGGCCGGCC GCTGCTGGAC       840
     AACCAGTTCA TCCAGTACAA GCTGGCCGAG CTCAAGACCG AGCTGGAGGC GCTGCGCTCG       900
     CTGACCTACC GCGCCACGCT GGCCTACGTC AACGGCGAGG ACGTGATCGA GCTCGCCTCC       960
     ATGGCCAAGC TCAAGGCCGG CCGCCTGGGC CGCGAGATCG CCGACTGGTG CATGCAGTTC      1020
     CAGGGCGGCA TGGGCTATAC CTGGGACAAC CGCGTCTCGC GCGCCTACCG CGACTACCGC      1080
     CTGGGCTCCA TCGGCGGCGG CGCCGACGAG GTGATGATGA TGGTCATCGC GCGCAAGATG      1140
     GGCCTGATGG ACATGGGAGC TTGA                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page